HBVdb

Dataset for protein SHBs of genotype B

[Download (right click)] [Sequences] [Repertoires]

6441 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KU964139_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
JN980249_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB010289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB010290_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB010291_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB010292_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB014366_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB030509_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB031266_SHBs_P-B      MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB031267_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB033554_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB033555_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB048705_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
AB073821_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCXG
AB073822_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073823_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AB073824_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073828_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073829_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073831_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073832_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
AB073833_SHBs_P-B      MENIASGLLGPLLVLQAGFXSLTKILTIPQSLDSWWTSLNFLGETPVCPG
AB073835_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
AB073837_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073838_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHG
AB073839_SHBs_P-B      METISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDPLVCLG
AB073840_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGGTPVCLG
AB073841_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB073842_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
AB073843_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLG
AB073844_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB073845_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB073847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPG
AB073848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073849_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
AB073850_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGPPVCPG
AB073853_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDLWWTSLSFLGEPPVCHG
AB073854_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB073855_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLG
AB073856_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB073857_SHBs_P-B      MENIASGLLGPLLVLQARFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AB073858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB100695_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGETPVCLG
AB106884_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB115551_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLG
AB117759_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPG
AB195934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB205119_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB205120_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB205121_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGTPVCLG
AB205122_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB212625_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB212626_SHBs_P-B      MGNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGKPVCLG
AB219426_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB219427_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB219428_SHBs_C-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB219429_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB231909_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB232112_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB232506_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNSLGETPVCRG
AB232519_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB241116_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB241117_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB246340_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB246341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB246343_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLSFLGETPVCLG
AB253402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253404_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253405_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253414_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253608_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
AB253609_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253614_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253617_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253618_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253619_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
AB253621_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253622_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287316_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
AB287318_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
AB287319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287320_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
AB287321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
AB287322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB287323_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEMPGCLG
AB287325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
AB287326_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB287329_SHBs_P-B      MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB289695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB289713_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB289738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB300364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB300370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB300371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB302095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
AB302942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB302945_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB362933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLG
AB365441_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
AB365445_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AB368295_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
AB471854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWNSLNFLGGTPVCLG
AB493827_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB493833_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB493835_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB555498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEKPVCLG
AB555499_SHBs_P-B      MENIASGLPGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB642093_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCXG
AB642094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB642101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGEAPVCPG
AB713527_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB713528_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB713529_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB713530_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB713531_SHBs_P-B      MEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB809488_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESPVCLG
AB809524_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHG
AB809529_SHBs_P-B      MENIASGLLGPLLALQAAFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB809552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
AB828708_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB900095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
AB900096_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
AB900097_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
AB900098_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB900102_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
AB900103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AB900104_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB900105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB900106_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCFG
AB900107_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB900108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
AB900110_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCPG
AB900111_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB900112_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB931168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPG
AB931169_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGVPPVCPG
AF013629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
AF013630_SHBs_P-B      MEKIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF061527_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121247_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AF121248_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121250_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121251_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGQTPVCLG
AF279464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF282917_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AF282918_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF411291_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF415217_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
AF461360_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AJ297873_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AJ627225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
AP011084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011086_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011091_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011094_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY033072_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY033073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY163869_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY167093_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY167094_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
AY167098_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY167100_SHBs_P-B      MENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AY167101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLG
AY167102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGIPVCLG
AY206373_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY206375_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY206383_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AY206387_SHBs_P-B      MENIASGLLGPLLVLQAGFFWLTKILTIPQSLDLWWTSLSFLGGPPVCLG
AY206390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY206391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AY217355_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY217356_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY217359_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY217362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY217368_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY220697_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
AY220698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY220703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY220704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY517489_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY596102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY596103_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY596104_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY596105_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY596109_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY596111_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
AY738926_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738931_SHBs_P-B      MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738932_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AY738936_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738937_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738939_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY766463_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY800389_SHBs_P-B      MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY800391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHG
D00329_SHBs_P-B        MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
D00330_SHBs_P-B        MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
D00331_SHBs_C-B        MENIASGLLGPLLVLQAGFFSLTKILTIPLSLDSWWTSLNFLGETPVCLG
D23678_SHBs_P-B        MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
D23679_SHBs_P-B        MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
D50521_SHBs_P-B        MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
D50522_SHBs_P-B        MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141615_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141618_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPEGLG
DQ141619_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141621_SHBs_P-B      MENIASGLLGPLLVVQEGIFSLTKILTIPQSLESGWTSLNFLGETPVGLG
DQ141624_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGTPVCLG
DQ141628_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141630_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141631_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ141634_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141635_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141636_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSGWTSLNFLGGTPVCLG
DQ141637_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141639_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141640_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
DQ141642_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141643_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141644_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141646_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141648_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141649_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141650_SHBs_P-B      MENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGTPVCLG
DQ141653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141655_SHBs_P-B      MENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRGTPVCLG
DQ361535_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412177_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLG
DQ412178_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412179_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412180_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412181_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412182_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412183_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLSFLGGTPACLG
DQ412184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412185_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
DQ412186_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLSFLGGTPECLG
DQ412188_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412189_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412190_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ412191_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412192_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ412193_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412194_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412195_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ412196_SHBs_P-B      MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412197_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412198_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCPG
DQ412199_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLEGTPVCRG
DQ412200_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
DQ412201_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412202_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
DQ412203_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412204_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGGTPVCLG
DQ412205_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412206_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412207_SHBs_P-B      MENIASGLLGPLLVVPAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ412208_SHBs_P-B      MENIASGLLGPLLAVQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412209_SHBs_P-B      MENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGEPPVCLG
DQ412211_SHBs_P-B      MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ412214_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
DQ412216_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLG
DQ412217_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412220_SHBs_P-B      MENIXSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGETPVCLG
DQ412222_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFPGGTPVCLG
DQ412223_SHBs_P-B      MENIASGLLGPLLALQAGFFSLIKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ412224_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCHG
DQ412225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
DQ412226_SHBs_P-B      MENIVSGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ463787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
DQ463789_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ463790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ463791_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCPG
DQ463794_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEPPVCPG
DQ463795_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGGTPECLG
DQ463796_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ463797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGGTPVCLG
DQ463799_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
DQ463800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ463801_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCLG
DQ463802_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ904357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ993681_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993682_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCRG
DQ993684_SHBs_P-B      MENIASGLQGPLLVLQAGFFLLTKSLTIPQSLDSWWTSLNFLGGTPVCLG
DQ993687_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLNFPGGTPVCLG
DQ993696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLVGAPVCLD
DQ993698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLG
DQ993699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLG
DQ993700_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993701_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993705_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ995801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
DQ995802_SHBs_P-B      MENISSGLLGPLLVLRAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLG
DQ995804_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLGFPGGTPVCLG
EF134945_SHBs_P-B      MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF134946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF494380_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF494381_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EF494382_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
EU075308_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131110_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLNFLGGTPVCLG
EU131112_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131113_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131114_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131115_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131118_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131119_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131120_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131121_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131123_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131124_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131126_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131127_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131128_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131129_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU131130_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139529_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139533_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU158262_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU305547_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU305548_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306678_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330989_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330994_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330995_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLG
EU330998_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU331000_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU439021_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU439022_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU439023_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU487256_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU487257_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU522066_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU522067_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU522072_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU522073_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU547563_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCXG
EU564822_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCLG
EU564823_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU564824_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU564826_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU570075_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPACLG
EU579441_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFPGGTPVCLG
EU589335_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
EU595031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU660224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU660231_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLG
EU660233_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGETPVCLG
EU796067_SHBs_P-B      MENIASGLLGPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU796068_SHBs_P-B      MVNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU881997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU881998_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU882003_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU882004_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU915485_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU919171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
EU919172_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU919173_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU921791_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU921794_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
EU926436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926437_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926450_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926455_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926460_SHBs_P-B      MENIASGLLGPLLVLQAGYFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926462_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926471_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926473_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927155_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927181_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927190_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU927192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
EU927198_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927201_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927215_SHBs_P-B      MENIASGPLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU927216_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927220_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927223_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU927224_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927226_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
EU927231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927242_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
EU927243_SHBs_P-B      MENIASGLLGPLLVLQAGFFXXTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927244_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927247_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
EU927272_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927284_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCXG
EU939559_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939635_SHBs_P-B      MENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939636_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU939637_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU939638_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGETPVCLG
EU939639_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939660_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939661_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939664_SHBs_P-B      MENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGEXPVCLG
EU939666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939667_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
EU939669_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU939670_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFLGGTPVCHG
EU939671_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939672_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLG
EU939673_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939674_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU939675_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU939676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939677_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLG
EU939678_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023631_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
FJ023633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023636_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023637_SHBs_P-B      MENIXSXLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023739_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023741_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023743_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023749_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023776_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023797_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023801_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ023814_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ023816_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023829_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023831_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023832_SHBs_P-B      MDNTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
FJ023846_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023871_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023873_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023893_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023899_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ023900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
FJ023903_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023909_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023913_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023918_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023919_SHBs_P-B      MENIASGLLAPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
FJ023924_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023951_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023963_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023964_SHBs_P-B      MENIXSGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023989_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023990_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
FJ024018_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024019_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024030_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024032_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024033_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ024040_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024041_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024044_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024046_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ032342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
FJ032344_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCRG
FJ032349_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ032352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ032353_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ032357_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ032358_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLAKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ386600_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386608_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
FJ386610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386615_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
FJ386636_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386642_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386655_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386656_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
FJ386658_SHBs_P-B      MENIASGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ386666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386669_SHBs_P-B      MENISSGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ386675_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386676_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ386681_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386682_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ386683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386688_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ518812_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ560992_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ560995_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPHSLNSWWTSLNFLGGTPVCLG
FJ560996_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWLTSLNFLGETPVCLG
FJ561007_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ561009_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561013_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561015_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561024_SHBs_P-B      MENNASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561027_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
FJ561038_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561044_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSXXTSLNFLGGTPVCLG
FJ562219_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562224_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562234_SHBs_P-B      MENIASGLLGPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562236_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
FJ562237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562246_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562253_SHBs_P-B      MENITSGLLGPLLVLQAGFSLLIKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562254_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562257_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562259_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
FJ562260_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLSFLGGTPVCLG
FJ562262_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562296_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562303_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562311_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562312_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ562316_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ562321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621592_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621602_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
FJ621603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621607_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621612_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621615_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621616_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621617_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621618_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621620_SHBs_P-B      MENIASGLPGPLLVLQAGYFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621622_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621623_SHBs_P-B      MENIASGLLRPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621624_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621625_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621626_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
FJ621628_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621630_SHBs_P-B      MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621631_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621632_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621633_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621635_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621636_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621637_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621638_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621639_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621640_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621641_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621642_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621643_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
FJ621644_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHG
FJ621646_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
FJ621647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCRG
FJ621650_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
FJ621651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
FJ621652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621655_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621658_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621662_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621664_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621667_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621668_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621673_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621684_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621686_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621687_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621688_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621692_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621700_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621701_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621714_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621715_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621719_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621721_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621725_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621726_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621729_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621735_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621737_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621739_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621740_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621741_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621742_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621744_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621749_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621752_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621753_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCFG
FJ621755_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
FJ621756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621757_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECRG
FJ621758_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
FJ621759_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621761_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621762_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621763_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621764_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621768_SHBs_P-B      MENISSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621769_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621770_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621771_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621772_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621773_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621774_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621775_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621776_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621777_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621778_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621779_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621780_SHBs_P-B      XXNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGVTPVCLG
FJ621781_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621785_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621786_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621788_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621789_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621791_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621795_SHBs_P-B      MESIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621796_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621797_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621801_SHBs_P-B      MENIASGLLGPLLALQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621802_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQRLDSWWTSLNFLGETPVCLG
FJ621803_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621804_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621806_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621809_SHBs_P-B      MENISSGLLGPLIELQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ709490_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ743737_SHBs_P-B      MENISSGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751273_SHBs_P-B      MENIASRLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751276_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751278_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGDTPVCLG
FJ751283_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751293_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
FJ751296_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751299_SHBs_P-B      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751307_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751312_SHBs_P-B      MENITSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751314_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751317_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751347_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751356_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLG
FJ751359_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751366_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751369_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751376_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCPG
FJ751390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751391_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751400_SHBs_P-B      MESTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGTPVCLG
FJ751406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751408_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751411_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751415_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
FJ751416_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751435_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751450_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751453_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
FJ751466_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751469_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751479_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDIPVCPG
FJ751480_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751482_SHBs_P-B      MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLRFLGGTPVCLG
FJ751490_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751495_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751498_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751504_SHBs_P-B      MESTTSRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751505_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751508_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751509_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751511_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLIFLGGTPVCLG
FJ751518_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751522_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751523_SHBs_P-B      MESTTSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751526_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751530_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEAPVCLG
FJ751531_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751535_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCPG
FJ751537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCFG
FJ751555_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCPG
FJ751566_SHBs_P-B      MENTASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751571_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKIHTIPQSLDSWWTSLNFLGGTPECLG
FJ751579_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751585_SHBs_P-B      MENTTSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751595_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGGSPVCLG
FJ751610_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ751612_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ787475_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ787477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ899779_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ899784_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLG
FJ899787_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGETLVCLG
FJ919933_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEPPVCLG
FJ919934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FM200206_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295499_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FN295522_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295539_SHBs_P-B      MENIXSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821800_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
FR821801_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
FR821803_SHBs_P-B      MENIASGRLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821804_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821809_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLG
FR821844_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821892_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821902_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821906_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
FR821911_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821914_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821937_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLIKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821940_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821975_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821978_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822020_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
FR822021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822032_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822044_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822060_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822063_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822065_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822070_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822072_SHBs_P-B      MEGTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822080_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
FR822084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR822089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822090_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822106_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822107_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822109_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822132_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822158_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822160_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822161_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822163_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLG
GQ325780_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325781_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ325783_SHBs_P-B      MENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ325787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325788_SHBs_P-B      MENIASGLXXPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLG
GQ325789_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325791_SHBs_P-B      MENIASGLLGPLLVLXAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325793_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
GQ325795_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ325796_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ358137_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358139_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
GQ358140_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358143_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ358144_SHBs_P-B      MENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRGTPVCLG
GQ377525_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ377537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377542_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377561_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377567_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377582_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377587_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377606_SHBs_P-B      MENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ377610_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ377612_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377622_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ377629_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ377644_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLG
GQ475340_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486038_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486050_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCLG
GQ486057_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ486084_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGETPVCLG
GQ486089_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486106_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486123_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486155_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486159_SHBs_P-B      MENIASGLXGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGXXPVCLG
GQ486161_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ486190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXXVCLG
GQ486196_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
GQ486219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
GQ486227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGEIPVCXG
GQ486233_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLG
GQ486242_SHBs_P-B      MENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXXPVCLG
GQ486245_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486277_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
GQ486291_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNXLGXXPXCLG
GQ486300_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486334_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486353_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGGTPVCLG
GQ486359_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486364_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486366_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486373_SHBs_P-B      MENITSGLLGPLLVLQXVFFLLTKILTIPQSLDSWWTSLSFLGDKPVCRG
GQ486377_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCXG
GQ486385_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLXFLGETPVCXG
GQ486395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486400_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGXTPVCLG
GQ486436_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGXTPVCLG
GQ486443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486444_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486447_SHBs_P-B      MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486448_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486449_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486452_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486455_SHBs_P-B      MENIASXLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLG
GQ486459_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLG
GQ486500_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486508_SHBs_P-B      MENIASGLLGPXLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486512_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486522_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486523_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486540_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGGTPVCLG
GQ486558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGTPVCLG
GQ486569_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486573_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486588_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLXGTPVCXG
GQ486620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486628_SHBs_P-B      MENIASGLLXPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486629_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486630_SHBs_P-B      MENIASGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486633_SHBs_P-B      MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486636_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKIXTIPQSLDSWWTSLNFLGXTPVCLG
GQ486640_SHBs_P-B      MENIASGLLGPLLVLQAGFXLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
GQ486644_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
GQ486657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486689_SHBs_P-B      MENIXSGXLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486739_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486749_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486752_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486761_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486784_SHBs_P-B      MENIASGHLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486788_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486789_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486792_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCHG
GQ486795_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ486796_SHBs_P-B      MENIASGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
GQ486797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486799_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIXQSLDSWWTSLNFLGETPVCLG
GQ486801_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486802_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486804_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPACLG
GQ486805_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486823_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486824_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSXWTSLXFLGGTPVCLG
GQ486832_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQXLDXWWTSLSFLGGTPVCLG
GQ486833_SHBs_P-B      MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486841_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GQ486850_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTXVCXG
GQ486852_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486860_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486862_SHBs_P-B      MENIXSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLXGTPVCLG
GQ486863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ486864_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486865_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFXGGTPVCLG
GQ486870_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCXG
GQ486873_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
GQ924606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924607_SHBs_P-B      MENIASGLIGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924617_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLG
GQ924621_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924624_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924625_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCRG
GQ924630_SHBs_P-B      MENIASGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
GQ924638_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924639_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924641_SHBs_P-B      MENIASGLLGPLLVLQVGFSLLTKILTIPQSLDSWWTSLSFLGGTPACLG
GQ924644_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924645_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFREGTPVCPG
GQ924646_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924656_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GU078805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078806_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078821_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU078838_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078845_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078849_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU079201_SHBs_P-B      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACPG
GU079210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079251_SHBs_P-B      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
GU079268_SHBs_P-B      MDNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GU079272_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
GU079278_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079298_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079329_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
GU079350_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079358_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079361_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079372_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
GU079382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079385_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079397_SHBs_P-B      MDNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079415_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079428_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079444_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU079448_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079449_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079463_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
GU079489_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079491_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU357842_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
GU358470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
GU358471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU358472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU358473_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU434372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815550_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815554_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815561_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815574_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
GU815584_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815587_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLG
GU815602_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815607_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815608_SHBs_P-B      MENIASGLLGPLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815610_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815616_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815617_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815618_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLG
GU815620_SHBs_P-B      MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815625_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815635_SHBs_P-B      MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815639_SHBs_P-B      MENIASGLLEPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815643_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815644_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815651_SHBs_P-B      MENIASGLLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815656_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815658_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815670_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815678_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815701_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815710_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815713_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815718_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815735_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815743_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815747_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815749_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815752_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815761_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815770_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815772_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815773_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815774_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815775_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815777_SHBs_P-B      MENITSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
GU815780_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GU815783_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652134_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652137_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652138_SHBs_P-B      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652139_SHBs_P-B      MESTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652140_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652141_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652143_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652144_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652145_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652147_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652148_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652150_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652151_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
HE652153_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652154_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
HE652160_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652161_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652165_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652166_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
HE652168_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652172_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652174_SHBs_P-B      MESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652176_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652177_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652181_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652183_SHBs_P-B      MENTTSGFQGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652187_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGEPPVCRG
HE652188_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652197_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652198_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652199_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652201_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652202_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPHSLDSWWTSLNFLGEPPVCRG
HE652203_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652207_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652214_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652216_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652219_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652225_SHBs_P-B      MENIASGLLGPLLVLQARFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652230_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652232_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652241_SHBs_P-B      MENIASELLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652243_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652248_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652249_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLIKILAIPQSLDSWWTSLNFLGGTPVCLG
HE652252_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGGTPVCLG
HE652255_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652258_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652269_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
HE652276_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652279_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652282_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLG
HE652285_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652287_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
HE652290_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652293_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652298_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652300_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652301_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652316_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652324_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652330_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
HE652332_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652334_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652336_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPHSLDSWWTSLNFLGGTPVCLG
HE652365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652376_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652379_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652381_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
HE652391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652408_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652410_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652423_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652426_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652429_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652434_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTVPQSLDSWWTSPNFLGGTPVCLG
HE652435_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652442_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652447_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652450_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652456_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
HE652459_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSVNFLGGTPVCLG
HE652463_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLDFLGGTPVCLG
HE652474_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652478_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652485_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGTPVCLG
HE652495_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652503_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILVIPQSLDSWWTSLNFLGGTPVCLG
HE652509_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLG
HE652510_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652514_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652515_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652519_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652524_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652543_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652547_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652564_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652568_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652569_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652573_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652579_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652580_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652588_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652589_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652595_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
HE652601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
HE652602_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652603_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
HE652604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652606_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652607_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652610_SHBs_P-B      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652611_SHBs_P-B      MENXXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
HE652612_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652615_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652618_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652621_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
HE652622_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652623_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652625_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652628_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652630_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652637_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTPVCLG
HE652641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
HE652651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652662_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
HE652663_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652673_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652674_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652748_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTPVCLG
HE652750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652757_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLG
HE652758_SHBs_P-B      MENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652761_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652762_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652765_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652766_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652767_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652771_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652772_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652774_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652775_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652780_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652781_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652782_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652791_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652834_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652835_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652840_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSPNFLGGTPVCLG
HE652847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652848_SHBs_P-B      MENIASGLLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652857_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652859_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HM011466_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEKLVCPG
HM011467_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
HM011469_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXXPVCXG
HM011470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
HM011471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGETPVCLG
HM011473_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGETPVCXG
HM011474_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCRG
HM011475_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
HM011476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCRG
HM011477_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
HM011478_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXXPXCXG
HM011480_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLSFLGETPVCLG
HM011482_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
HM011483_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
HM011484_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKXLTIPQXLDXWWTSLSFLGVPPVCPG
HM011487_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLG
HM011490_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
HM011492_SHBs_P-B      MENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLG
HM011494_SHBs_P-B      MENIASGLLGPLLVLQAGFXXLXKILTIPQSLDSWWTSLXFLGGTPVCLG
HM011496_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HM011499_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
HM011503_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
HM011504_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HM153811_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HM590576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
HQ700546_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HQ700548_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HQ700549_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JF436921_SHBs_P-B      MATNLSELLKLLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604119_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JN604123_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JN604127_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLG
JN604132_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN604138_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIPTIPQSLDSWWTSLSFLGGTPVCLG
JN604141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604142_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLIKILTIPQSLDLWWTSLNFLGGTPVCLG
JN604149_SHBs_P-B      MDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604187_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604212_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
JN604213_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGDTPVCLG
JN604219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604221_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILXIPQSLDSWWTSLNFLGETPVCLG
JN604224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLG
JN604234_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFXGGTPVCLG
JN604244_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN604253_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JN604267_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
JN604311_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN650140_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650144_SHBs_P-B      MENNSSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650153_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650155_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650157_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN650159_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN650166_SHBs_P-B      MENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650170_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JN650177_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650191_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650196_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JN792894_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
JN792896_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN792900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN792901_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN792902_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN827419_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN980198_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980207_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980216_SHBs_P-B      MESIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980218_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980220_SHBs_P-B      MESIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGPPVCHG
JN980231_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980234_SHBs_P-B      MESITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPACLG
JN980237_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980239_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980250_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980263_SHBs_P-B      MESIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980274_SHBs_P-B      MENISSGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980277_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
JN980309_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980322_SHBs_P-B      MEKYSSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JN980348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980376_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980379_SHBs_P-B      MQNIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPG
JN980382_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN980383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDLWWTSLSFLGGTPVCLG
JN980391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDWWWTSLSFLGGTPVCLG
JN980393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGTPVCLG
JQ027311_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLXFLGGTXXCLG
JQ027312_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ027315_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ027316_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ027325_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGGTPVCLG
JQ027330_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ027334_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ040128_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ040138_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGTPVCLG
JQ040147_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
JQ040157_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
JQ040170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341550_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341551_SHBs_P-B      MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341553_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
JQ341554_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341557_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JQ341558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341559_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JQ341560_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341562_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341563_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341564_SHBs_P-B      MENIASGLLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341565_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341566_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSXWTSLNFLGGTPVCLG
JQ341567_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGEXPVCLG
JQ341568_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341569_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341571_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ341572_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341573_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPACLG
JQ341577_SHBs_P-B      MENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPXCLG
JQ341580_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341582_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341585_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341586_SHBs_P-B      MENIASGLLXPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
JQ341587_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEPPVCPG
JQ341589_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341590_SHBs_P-B      MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341591_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGXTPVCLG
JQ341592_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341595_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLSFLGGTXVCLG
JQ341596_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341597_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341598_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
JQ341600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ341601_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341604_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341605_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
JQ341606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTXVCLG
JQ341607_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGXTPVCLG
JQ341608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ412090_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ412092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416164_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ416176_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416305_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ429079_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ429081_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ429082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707734_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707735_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707739_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707740_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707747_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707749_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707755_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707764_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ707767_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801474_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ801494_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEKTVCLG
JQ801516_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCFG
JX026879_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JX026881_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX026883_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JX026886_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JX292746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292760_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFPGETPACLG
JX429897_SHBs_P-B      MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGETLVCLG
JX429901_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JX429908_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX429910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX429911_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX504531_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX504532_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
JX504533_SHBs_P-B      MENIASGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX504538_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX504543_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLG
JX507200_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX507202_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX507208_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JX507213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661479_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661480_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510646_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510655_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774362_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774368_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774376_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774377_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774380_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774388_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774397_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC774400_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774412_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774413_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC774415_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774416_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774418_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792648_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSXLGXTXVCLG
KC792650_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLIKILTIPQSLDSWWTSLXFLGGTPVCLG
KC792651_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCXG
KC792652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792654_SHBs_P-B      MENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNXLGETPVCLG
KC792657_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792659_SHBs_P-B      MENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPXCLG
KC792660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792661_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPGCLG
KC792662_SHBs_P-B      MENIASGXLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792663_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792665_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTXXCLG
KC792666_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLG
KC792668_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792670_SHBs_P-B      MENIXSGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFXGGXPVCLG
KC792671_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEPPGCLG
KC792674_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792675_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792676_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLG
KC792677_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLSFLGXTPVCLG
KC792681_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792683_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPXCLG
KC792684_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792686_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792688_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792689_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792692_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC792693_SHBs_P-B      MENITSGLLGPLLVLQXGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792694_SHBs_P-B      MENIXSGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPRCLG
KC792696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
KC792698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLG
KC792699_SHBs_P-B      MENIAXGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC792701_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KC792702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTECLG
KC792703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
KC792711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792715_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCXG
KC792717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
KC792718_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC792719_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLG
KC792721_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGGTPVCLG
KC792723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLSFLGXTPXCLG
KC792724_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792725_SHBs_P-B      MENIXSGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792726_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPXCLG
KC792727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792728_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792729_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792730_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTXVCXG
KC792732_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
KC792736_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCLG
KC792737_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
KC792738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792741_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792742_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792743_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792744_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGXTPVCLG
KC792745_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792748_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLG
KC792749_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPGCLG
KC792752_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792755_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792758_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792760_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
KC792761_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFXGETPVCLG
KC792763_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792764_SHBs_P-B      MDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLEGTXGCRG
KC792765_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792767_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792768_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
KC792769_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792770_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCLG
KC792773_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792774_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTXVCLG
KC792777_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWXSLNFRGGTPECLG
KC792778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
KC792780_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792781_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC792782_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXXLGETPVCLG
KC792783_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792785_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792786_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQXLDXWWTSLXFLGGTXXCLG
KC792787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792788_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792789_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792791_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTPVCXG
KC792794_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792796_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLXFLGGTPVCLG
KC792797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792800_SHBs_P-B      MENIASGLLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGETPVCFG
KC792801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792802_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792804_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792808_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILXIPQSLDXWWTSLXFLGXTPVCXG
KC792809_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTPECLG
KC792810_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792811_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFPGGTPVCLG
KC792812_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGETPVCLG
KC792813_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792814_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792815_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792819_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792820_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792821_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGETPVCLG
KC792822_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792824_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGETPVCPG
KC792825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792827_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
KC792829_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792832_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
KC792835_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLSFLGGTPVCLG
KC792837_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCPG
KC792839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792840_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKXLXIPQSLDSWWTSLNFXGGTPVCLG
KC792841_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792842_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792843_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLXGTPVCLG
KC792844_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792845_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCXG
KC792846_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCRG
KC792847_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGVTPVCLG
KC792848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792849_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792850_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGETPVCPG
KC792851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
KC792859_SHBs_P-B      MENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXXPVCPG
KC792860_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792861_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
KC792863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLXFLGXTPXCLG
KC792864_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792865_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETXVCXG
KC792866_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792867_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KC792869_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792870_SHBs_P-B      MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792871_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPXCLG
KC792874_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792875_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792877_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792878_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792879_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792881_SHBs_P-B      MENIASGLLGPLLALQAAFSLWTRILTIPQSLDSWWTSLSFLGGTPVCPG
KC792882_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792883_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGETPVCLG
KC792884_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPGCPG
KC792885_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
KC792887_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSLWTSLSFLGGTPVCLG
KC792888_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLG
KC792889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792890_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792891_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792892_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792894_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792896_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792897_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLG
KC792898_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KC792900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792901_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792903_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792904_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGXTPVCLG
KC792905_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792907_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792908_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792916_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792917_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792919_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792920_SHBs_P-B      MENIASGXLGPLLXLQAXFFLXTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792924_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792925_SHBs_P-B      MENISSGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792928_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQXLDLWWTSLSFLGGTPVCLG
KC792929_SHBs_P-B      MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792930_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792931_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792932_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCPG
KC792935_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792936_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC792937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KC792939_SHBs_P-B      MENIASGLLGPLLVLQAXFFLLTKILTIPQSLDSWWTSLSFLGGTXXCLG
KC792942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792945_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC792947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
KC792948_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792949_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792950_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792951_SHBs_P-B      MENIASGLXGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792953_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792954_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792955_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792956_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792958_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCFG
KC792959_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC792963_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792964_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792966_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLSFLGGTPVCLG
KC792967_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792969_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCPG
KC792970_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC792973_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792974_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC792975_SHBs_P-B      MENIXSGLLGPLLVFQAGFFLLTKILTIPMSLDSWWTSLSFLGGTTECLG
KC792976_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC792977_SHBs_P-B      MENIASGLLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792978_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792980_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792982_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792983_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGXTXVCLG
KC792985_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCPG
KC792986_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDXWXTSLNFLGXTPVCXG
KC792987_SHBs_P-B      MENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792988_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792990_SHBs_P-B      MENIASGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792991_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGTPVCLG
KC792992_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLG
KC792994_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792996_SHBs_P-B      MENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTXPRSLDSWWTSLNFLGETPVCLG
KC792998_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLG
KC793000_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGEKPVCLG
KC793001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793002_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793004_SHBs_P-B      MENXASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793005_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793006_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793008_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGXTPXCXG
KC793009_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGETPVCPG
KC793011_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGETXVCXG
KC793012_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793014_SHBs_P-B      MENISSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793015_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTXVCLG
KC793016_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLG
KC793017_SHBs_P-B      MENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLSFLGDTPVCLG
KC793018_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEXPVCLG
KC793020_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGIPVCLG
KC793021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793022_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793023_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPACLG
KC793025_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLG
KC793027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793028_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793029_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793032_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793033_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGERLVCLG
KC793034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGXXPVCLG
KC793036_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKVLTIPQSLDSWWTSLNFLGETPVCPG
KC793038_SHBs_P-B      MENIASGLLGPLLALQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793041_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793042_SHBs_P-B      MENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC793043_SHBs_P-B      MENITSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
KC793044_SHBs_P-B      MENXASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTXXCLG
KC793045_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793047_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793048_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793049_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793052_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTXCLG
KC793053_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KC793054_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793055_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793056_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPGCLG
KC793057_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793058_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793059_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KC793060_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KC793061_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793063_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793064_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793065_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTXVCLG
KC793067_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793069_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCPG
KC793070_SHBs_P-B      MENTTSGLLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793071_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC793072_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC793073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793076_SHBs_P-B      MENIASGLLGPLLVXQAGFFXLTKXLTIPQSLDSWWTSLNFLGXTPVCLG
KC793077_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793078_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793079_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPKCLG
KC793080_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793081_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLNFLGETPVCLG
KC793084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KC793086_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLG
KC793087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KC793088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793090_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793091_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793092_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793094_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793096_SHBs_P-B      MENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLG
KC793098_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793099_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793104_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKIHTIPQSLDSWWTSLNFLGETPVCLG
KC793106_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793109_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793111_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793113_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793114_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793115_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793116_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
KC793118_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC793120_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPXCLG
KC793121_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793122_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793124_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
KC793125_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793126_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC793127_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793128_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793130_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC793131_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793132_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793134_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793136_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793137_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLG
KC793138_SHBs_P-B      MENIXSGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793139_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC793140_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWLTSLSFLGETPVCLG
KC793143_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC793145_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGETPVCLG
KC793146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793147_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793148_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTXVCXG
KC793149_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCXG
KC793150_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793151_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXPVCXG
KC793152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
KC793153_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793154_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGEXPVCLG
KC793155_SHBs_P-B      MENIASGLXGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793156_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793157_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC793158_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC793159_SHBs_P-B      MENIASGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGAIPGCLG
KC793160_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793161_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793163_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPLSLDSWWTSLSFLGETPVCLG
KC793164_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793166_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793170_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793171_SHBs_P-B      MENIASGLLGPLLVLQAGYFSLTKVLTIPQSLDSWWTSLNFLGETPVCLG
KC793172_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXPVCLG
KC793173_SHBs_P-B      MENXASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC793174_SHBs_P-B      MEXIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTXVCLG
KC793175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KC793177_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGETPVCLG
KC793178_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793181_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793182_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCHG
KC793183_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793185_SHBs_P-B      MENIXSXXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXPVCLG
KC793186_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793188_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLSFLGGTPVCLG
KC793190_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793191_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
KC793192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793193_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793194_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793197_SHBs_P-B      MENIASGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793198_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
KC793199_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC793200_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KC836826_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF053162_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KF053174_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGETPVCLG
KF053180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KF053190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF053191_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KF053192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KF053194_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KF680546_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771924_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771931_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771932_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCHG
KF771937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771941_SHBs_P-B      MENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771942_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771950_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771959_SHBs_P-B      MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KF771966_SHBs_P-B      MENIASKLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ011543_SHBs_P-B      MENIASGLLGHLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011544_SHBs_P-B      MENIASGLLGPLLVLLAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ011545_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ011547_SHBs_P-B      MENIASGLLGPLIVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011551_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
KJ011553_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173298_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173343_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173351_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ173357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
KJ173371_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173375_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173377_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173378_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
KJ173379_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173380_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173383_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173384_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173385_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ173403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173404_SHBs_P-B      MKNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410500_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KJ410502_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ717795_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLNFLGETPVCLG
KJ717797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ717798_SHBs_P-B      MENIASGLLKPLLALQAGFFLLTKILTMPQSLDSWWTSLSFLGGTPVCLG
KJ717801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KJ717805_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ717806_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ717807_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ717808_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ717813_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGIPVCLG
KJ717817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGVPPVCLG
KJ717818_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ717820_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717829_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEKLVCPG
KJ717836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ717837_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNSLGETPVCPG
KJ717840_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPACLG
KJ717842_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ717843_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ790200_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ803752_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ843165_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLEGTPVCRG
KM213032_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNFLGETPVCLG
KM213034_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM213036_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KM455600_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM455602_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KM455604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KM455605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KM455606_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455612_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455621_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
KM455630_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455641_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455644_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
KM455651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM455660_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455691_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455700_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455705_SHBs_P-B      MENITSGLLRPLLTLQAGFFSLTKILTIPQSLDSWWTSLIFLGGTPVCLG
KM455706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455732_SHBs_P-B      MENITSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
KM455748_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455752_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455760_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455762_SHBs_P-B      MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGAPVCLG
KM455771_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455777_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455784_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455791_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKIHTIPQSLDSWWTSLNFLGGTPVCPG
KM455799_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTMPQSLDSWWTSLNFLGGTPVCLG
KM455804_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM455811_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455816_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACLG
KM455817_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455818_SHBs_P-B      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455819_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455820_SHBs_P-B      MESTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455828_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455831_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM455834_SHBs_P-B      MENSASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLHSWWTSLNFLGDTPVCPG
KM455840_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455844_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455846_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455849_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455851_SHBs_P-B      MENITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
KM455858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM606895_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGTPVCLG
KM875418_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM875426_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNSLGGTPVCLG
KM875427_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP036970_SHBs_P-B      MENIVSGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP148314_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148317_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148324_SHBs_P-B      MENIASGLLGPMLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148331_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148334_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148343_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148356_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148367_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148368_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTMPQSLDSWWTSPNFLGGTPVCLG
KP148374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148376_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148377_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148380_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGGTPVCLG
KP148383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148387_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148391_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIPTIPQSLGSWWTSLNFLGGTPVCLG
KP148407_SHBs_P-B      MENISSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148410_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148411_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148414_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148416_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148419_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148424_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148429_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148435_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148437_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148438_SHBs_P-B      MENIASGLVGPLLASQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148439_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148440_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148452_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148455_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148457_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTPVCLG
KP148458_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148581_SHBs_P-B      MENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148582_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406161_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406163_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406164_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406166_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406167_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406168_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406169_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406171_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406174_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406175_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406176_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406179_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406194_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406220_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGTPVCLG
KP406238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRNLDSWWTSLNFLGGTPVCLG
KP406244_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406245_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406247_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406250_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406253_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KP406255_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406256_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKALTIPQSLDSWWTSLNFLGETPVCLG
KP406258_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKALTIPQSLDSWWTSLNFLGETPVCLG
KP406262_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406264_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406265_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406266_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406267_SHBs_P-B      MDNITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406268_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406271_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406274_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406276_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406277_SHBs_P-B      MDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406278_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406279_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406280_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406281_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406284_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406286_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406288_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406295_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406296_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406297_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406298_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406301_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406303_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406311_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406318_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406327_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406330_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406331_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406332_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659220_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
KP659223_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KP659224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659227_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KP659234_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659235_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
KP659239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDLWWTSLNFLGDTPVCLG
KP659240_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTPVCLG
KP659244_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KP659245_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGGXPECLG
KP659246_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659248_SHBs_P-B      MENIASGLLAPLLALQAVFFLLTKILTIPQSLDSWWTSLNFLGGXPECXG
KP659249_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGVPPVCLG
KP659250_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KP659251_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLG
KP659252_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KP659253_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP659254_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KP659255_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
KP712839_SHBs_P-B      ----ASGLLGPLLXLQAGFFSLTKILTIPQSLDSXWTSLNFXGGTPVCLG
KP712842_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP712849_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILXIPQXLDXWWTSLNFLGXTPVCXG
KP712857_SHBs_P-B      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KP712865_SHBs_P-B      ----ASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP997622_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP997654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KR818863_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
KR818864_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
KR818865_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSLLGGTPVCLG
KR818866_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
KR818867_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
KT585762_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLG
KT585766_SHBs_P-B      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
KT585768_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLG
KT585779_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KT585781_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KT749820_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU234318_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963814_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963815_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963816_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963833_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSLWTSLNFLGGTPVCLG
KU963842_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963945_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963946_SHBs_P-B      METIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU963948_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963949_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963951_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963967_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLESWWTSLNFLGGTPVCLG
KU963970_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963976_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KU963979_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963980_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPECLG
KU964079_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964084_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964094_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGPPVCLG
KU964095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964096_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964108_SHBs_P-B      MENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964110_SHBs_P-B      MENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964111_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964115_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964118_SHBs_P-B      MENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964120_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964123_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964132_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964135_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964136_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTYLNFLGETPVCLG
KU964138_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964143_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDLWWTSLNFLGGTPVCLG
KU964153_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964154_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964155_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964156_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964158_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KU964159_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KU964161_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964163_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964166_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964244_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964245_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964246_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964248_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964250_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964257_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964258_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964259_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KU964260_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964265_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964267_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964269_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KU964272_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964280_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964283_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964286_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964287_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964291_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964293_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964300_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964302_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964381_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067099_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067127_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067251_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX067253_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067428_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
KX067672_SHBs_P-B      MENIPSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067748_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX067772_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276770_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KX276771_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTRVLTIPQSLDSWWTSLNFLGGTPVCLG
KX276772_SHBs_P-B      MENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX276773_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276775_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
KX276776_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFPGVTPVCLG
KX276777_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276781_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEIPVCLG
KX276782_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
KX276784_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX276785_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276786_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX276788_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276789_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
KX276790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276791_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCXG
KX276792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCXG
KX276793_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276794_SHBs_P-B      MENIASGLLGPLLVLQAXXFXLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276795_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGATPVCPG
KX276796_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXXPVCLG
KX276799_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQRLDSWWTSLNFLGETPVCLG
KX276801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276802_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276804_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGETPVCLG
KX276805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276806_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPXCLG
KX276807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTXVCLG
KX276810_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
KX276811_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276812_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276813_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQNLDSWWTSLNFLGXTPVCLG
KX276814_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276815_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEXPVCXG
KX276817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGXTPVCLG
KX276818_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276819_SHBs_P-B      MENIASRLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276820_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
KX276821_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLXFLGETPVCXG
KX276822_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEIPVCHG
KX276823_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
KX276824_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGGTPVCLG
KX276825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX276827_SHBs_P-B      MENXSSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276828_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276829_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETTVCLG
KX276830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276858_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGXTPVCLG
KX276962_SHBs_P-B      METIASGLLRPLLVLQAGFFLLTKILTMPQSLDSWWTSLNFLGGTPVCLG
KX276970_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276996_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372107_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX372109_SHBs_P-B      MENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372113_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372115_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372116_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX621096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682311_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX765841_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX765854_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777260_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777264_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777281_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777284_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777345_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777545_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777547_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777548_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777552_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777553_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777557_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX777562_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777563_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777566_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
KX777573_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273153_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273156_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273164_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCPG
KY273165_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY273166_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPRSLDSWWTSLNFLGETPVCPG
KY273167_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY273168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY273171_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY273172_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY273173_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY273178_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273185_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273189_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY273191_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
KY273192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KY302923_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302926_SHBs_P-B      IENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302930_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302933_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302936_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302939_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302945_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLSFLGGTPVCLG
KY302948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY302949_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302950_SHBs_P-B      MENIASGLLGPLLVLQAGFVLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302951_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302955_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302958_SHBs_P-B      MENIASGLLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302959_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGRTPVCLG
KY302960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY302961_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302962_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302966_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302987_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302988_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302990_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFLGETPVCLG
KY302991_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY302994_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302996_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302998_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302999_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303003_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303004_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303005_SHBs_P-B      MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303008_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303013_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303014_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303015_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303028_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY303029_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY303030_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY303031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTTVCLG
KY303033_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY303034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLIFLGGTTVCLG
KY303036_SHBs_P-B      MENIASGLLGLLLVLQAGFFLLTKILTIPQSLDSWWASLNFLEGTPVCLG
KY303069_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303072_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303077_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303078_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303081_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303097_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303098_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303209_SHBs_P-B      MENITSGLLGPVLVLQAGFFLLTKILTIPQSLDTWWTSLNFLGGTPVCLG
KY303211_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTLVCLG
KY303213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303217_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303229_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCFG
KY303231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303233_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTPLNFLGGTPVCLG
KY303239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303240_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIFTIPQSLDSWWTSLNFLGGTPVCLG
KY303241_SHBs_P-B      MENIASGLLGLLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303242_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303243_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303244_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303247_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
KY303250_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303255_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303257_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSPDSWWTSLNFLGGTPVCLG
KY303258_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303261_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303263_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303266_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
KY303269_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303272_SHBs_P-B      VENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303274_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303277_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303279_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303285_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KY303289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303290_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303303_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KY303310_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPMCLG
KY303347_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303351_SHBs_P-B      MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303353_SHBs_P-B      MENIASGLLGPLLVLQAGFILLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPGCLG
KY303359_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTPLNFLGGTPVCLG
KY303371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303394_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEETTVCLG
KY303428_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTILQSLDSWWTSLSFLGGTPVCLG
KY303429_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303430_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY303432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303437_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303439_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303441_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303444_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303448_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303449_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY303454_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303455_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303456_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303463_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316911_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316914_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316916_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316919_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY316920_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316922_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316923_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316924_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316927_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGGIPVCLG
KY316930_SHBs_P-B      MENIASGLLRPLLVLQAGFILLTKIHTIPQSLDSWWTSLNFLGGTPVCLG
KY316933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY316941_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTTPQSLDSWWTSLNFLGETPVCLG
KY316942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCXG
KY316943_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLG
KY316947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGGKPVCLG
KY316948_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY316949_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTECLG
KY316951_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
KY316954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY316957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316958_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
KY316959_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY360315_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360316_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360317_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360318_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360319_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSPNFLGETPVCLG
KY360320_SHBs_P-B      MENIASGLLGPLLALRAGFFSLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY360321_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360322_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360323_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY360324_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KY360325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360327_SHBs_P-B      MENIASGLLGPLLVLRAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCFG
KY360329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360330_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360331_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360332_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360336_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360338_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360345_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY360346_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLAKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360347_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360349_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360350_SHBs_P-B      MENIASGLLGPLLVLRAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360356_SHBs_P-B      MENIASGLLGPQLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360358_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTVPQSLDSWWTSLNFLGGTPVCLG
KY360365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360366_SHBs_P-B      MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY360369_SHBs_P-B      TENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360435_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360438_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360444_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360445_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360447_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360454_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360455_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360456_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360457_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360460_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY360461_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360464_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360466_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY360467_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360469_SHBs_P-B      MENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360473_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360475_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360479_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360483_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360484_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY360486_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360487_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360488_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360489_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360490_SHBs_P-B      MENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360500_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360503_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KY360504_SHBs_P-B      MEYIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360508_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360510_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360511_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360514_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360516_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPGCLG
KY360517_SHBs_P-B      MENIASGLLGPLLMLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360519_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360520_SHBs_P-B      MENIASGLLGPMLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360521_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360523_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KY360524_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360525_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360526_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360527_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360528_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360531_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360532_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY360536_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360538_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360542_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360543_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360546_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360548_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360550_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCRG
KY360592_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360595_SHBs_P-B      TENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360597_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
KY360609_SHBs_P-B      MENIALGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360621_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
KY360622_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY360623_SHBs_P-B      MENIASGLLGSLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360631_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360632_SHBs_P-B      MENIASGLLGPLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360636_SHBs_P-B      MGNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360642_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360644_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTVPQSLDSWWTSLNFLGGTPVCLG
KY360647_SHBs_P-B      MEIIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360652_SHBs_P-B      TENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360655_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLG
KY360657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360658_SHBs_P-B      MENIATGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
KY360668_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360670_SHBs_P-B      MENVASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360675_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTPVCLG
KY360676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSPDSWWTSLNFLGGTPVCLG
KY360677_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360678_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGVTPVCLG
KY360679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLG
KY360681_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360690_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360691_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLG
KY360692_SHBs_P-B      MEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360693_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360699_SHBs_P-B      MEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360700_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIPTIPQSLDSWWTSLNFLGGTPVCLG
KY360704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTILQSLDSWWTSLNFLGGTPVCLG
KY360713_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360716_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGRTPVCLG
KY360717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360725_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360729_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360735_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360737_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY360738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360741_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360865_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360868_SHBs_P-B      MENIASGLLGPLLVLRAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360885_SHBs_P-B      MENIASRLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360886_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360890_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360892_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360905_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360924_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSPNFLGGTPVCLG
KY360928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360929_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTSVCLG
KY360930_SHBs_P-B      MENIASGLLGPLLMLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGTPVCLG
KY360946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGTPVCLG
KY361030_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSPNFLGGTPVCLG
KY361032_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361036_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361037_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361049_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361050_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWSSLNFLGGTPVCLG
KY361067_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361069_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361070_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361089_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361090_SHBs_P-B      MENIASGLLGPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361091_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGTPVCLG
KY361095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361109_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361112_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLG
KY361113_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361115_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVYLG
KY361116_SHBs_P-B      MEDTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361117_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361148_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361154_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361155_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361166_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361172_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361173_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361174_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY361183_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361184_SHBs_P-B      MENIASGPLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361185_SHBs_P-B      MENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361186_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361188_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361191_SHBs_P-B      MENIASGPLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361204_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361205_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361208_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLG
KY361211_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361212_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361223_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361226_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLGSWWTSLSFLGGTPVCLG
KY361229_SHBs_P-B      VENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETPVCLG
KY361461_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361499_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361501_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361513_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGTPVCLG
KY361517_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361519_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361529_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGGTPVCLG
KY361530_SHBs_P-B      MENIASGLLGLLLVLQAGFFLLTKVLTIPQSLDSWWTSLSFLGGTPVCLG
KY361531_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361532_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361533_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361536_SHBs_P-B      TENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCLG
KY361538_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCLG
KY361551_SHBs_P-B      MEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361553_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361554_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361573_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361574_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361578_SHBs_P-B      MENIASGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361579_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361590_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTPLNFLGGTPVCLG
KY361591_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361592_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361593_SHBs_P-B      MENTASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361595_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361596_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361611_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361704_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY417926_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460009_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460010_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460014_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460015_SHBs_P-B      MENIASGLLGPLLVLQGGVFWLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460016_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460017_SHBs_P-B      MENIASGLLGPLLVLLAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460018_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY460019_SHBs_P-B      MENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460020_SHBs_P-B      MENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KY460021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460022_SHBs_P-B      MENIASGLLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY460023_SHBs_P-B      IENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY460024_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KY460046_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460048_SHBs_P-B      MENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460051_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRISLKFLGGTPVCLG
KY460052_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460065_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460066_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGGTPVCLG
KY460068_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460070_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460090_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460097_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVRLG
KY460099_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470834_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470835_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470953_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLDFLGGTPVCLG
KY470954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY629635_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KY881780_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881785_SHBs_P-B      VENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881787_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881791_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881794_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881795_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881796_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881799_SHBs_P-B      MEKIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881808_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSRWTSLNFLGETPVCLG
KY881820_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881821_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881822_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881823_SHBs_P-B      TENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881824_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881825_SHBs_P-B      MENIASGHLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881826_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881827_SHBs_P-B      MENIVSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881831_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881833_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881834_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881835_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLS
KY881836_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881838_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881841_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881842_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881843_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881844_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFPGGTPVCLG
KY881848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881849_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KY881850_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881853_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KY881857_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881861_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881864_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KY881865_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881867_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KY881869_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGETPVCRG
KY881893_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881904_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881907_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLSFLGGTPVCLG
KY881911_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KY881912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KY881913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881944_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881945_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881952_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881954_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881955_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881957_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349868_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349870_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349871_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349872_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349874_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPRSLDSWWTSLNFLGETPVCLG
LC349875_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349879_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
LC461174_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEXXXCXG
LC461175_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGEXXXCXG
LC603638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNSLGETPVCLG
LT992442_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF621878_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
MF674385_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674392_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674396_SHBs_P-B      MENIASGLPGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674406_SHBs_P-B      MENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGTPVCLG
MF674409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674414_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674415_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674416_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674422_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MF674424_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674426_SHBs_P-B      MENIASGLLGPLLVLQAGVFFFXKNLTKPHSLDSWWTSLNFLGGTPVCLG
MF674434_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674436_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674438_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674439_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674440_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674441_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674445_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674446_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
MF674447_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674459_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674462_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674464_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MF674465_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MF674466_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674469_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGTPVCLG
MF674473_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674478_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPGCPG
MF674479_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674481_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674491_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MF674492_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLG
MF674496_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674505_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674506_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674508_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674512_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF682470_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF682472_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MF682486_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG372436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEGTPVCLG
MG383610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
MG571323_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571324_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG571325_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
MG571326_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
MG571327_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILIIPQSLDSWWTSLNFLGETPVCLG
MG571329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGDTPVCLG
MG571331_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG571333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
MG571334_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGATPVCLG
MG571336_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGDTPVCPG
MG571337_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571338_SHBs_P-B      MENTXLKLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571339_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG571341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG571347_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571350_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571351_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGXPECLG
MG571352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG571353_SHBs_P-B      MENTASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLG
MG571354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
MG571355_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG571358_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG571361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571366_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571370_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG571372_SHBs_P-B      MENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571376_SHBs_P-B      MENTASGPLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLG
MG714927_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714941_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG714945_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILXIPQSLDSWWTSLNFLGGTPVCLG
MG714946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG714952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLKKILTIPQSLDSWWTSLNFLGETPVCLG
MG714954_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG714955_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714956_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714959_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714962_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLXXTXVCLG
MG714966_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGGTPVCLG
MG715000_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGTPVCLG
MG715002_SHBs_P-B      MENIASGLLGPLLXLQAGFXLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715004_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715009_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715010_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715017_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTTVCLG
MG715030_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715041_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715046_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715050_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
MG715052_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715065_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDXWWTSLNFLGGTXVCLG
MG715067_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG715071_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715079_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715080_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLXGTPVCLG
MG715100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715110_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715119_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715123_SHBs_P-B      XENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715125_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715135_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
MG715143_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715151_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715154_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715155_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715166_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715168_SHBs_P-B      MENTASGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715169_SHBs_P-B      -ENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715173_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
MG715178_SHBs_P-B      MENIASGLLGPLLGLQGGFFLLTKILTIPQSLDSWWTSLXFLGXTPVCLG
MG715180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715181_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715183_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
MG715185_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715186_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715188_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715193_SHBs_P-B      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715195_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSXDSWWTSLNFLGGTXVCLG
MG715199_SHBs_P-B      MENIASGLLGPXLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715209_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCXG
MG715214_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCXG
MG715220_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715232_SHBs_P-B      MENIPSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715233_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715237_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715242_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715245_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715246_SHBs_P-B      MENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715247_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715261_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715265_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715273_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715275_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715298_SHBs_P-B      MENIASGLLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715337_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715340_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGXTPVCXG
MG715347_SHBs_P-B      MENXASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715350_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715353_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715356_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
MG715374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG715401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLNFLGETPVCLG
MG738732_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MG738735_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MG738736_SHBs_P-B      ---IASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG738738_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG738740_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG738742_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826152_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLG
MG826153_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826155_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG826156_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826157_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826158_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG826159_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826160_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG826161_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTMCLG
MG826163_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826164_SHBs_P-B      MENISSGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826165_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGPPVCLG
MG826172_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826173_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826177_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG826178_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MG826180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826182_SHBs_P-B      MENIASGLLGPLLVYRAGFFLLTKILTIPRSLDSWWTSLSFLGGTPVCLG
MG826192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG826199_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPACPG
MG826201_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826203_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826206_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826209_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
MG826210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG826215_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG826216_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCRG
MG826359_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK170855_SHBs_P-B      MENISSGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170869_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK170871_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170885_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170887_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170891_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK170892_SHBs_P-B      MSNIGSRLLGPLLPLPAAFFLLTRILTIPLTLHSRWTSLNFLGGTSVCFA
MK170914_SHBs_P-B      MENTASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170920_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK170924_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCRG
MK170934_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170949_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170953_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170976_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETLVCLG
MK170977_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170978_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170985_SHBs_P-B      MENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170986_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGVTPVCLG
MK170987_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171000_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFPGGTPGCLG
MK171009_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCLG
MK171014_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171015_SHBs_P-B      MENTSSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171019_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171029_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171068_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171073_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MK171080_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171081_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
MK171087_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171096_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171101_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171127_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171133_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171135_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171155_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGVPPVCLG
MK171156_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171165_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTPVCLG
MK171168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171171_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171178_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPECLG
MK171185_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171186_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171201_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171207_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171214_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171218_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
MK171219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MK171239_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171252_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MK534591_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534611_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534612_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534614_SHBs_P-B      MENITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MK534621_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK534627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
MK534661_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534673_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK534676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK534680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534691_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK534692_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534694_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534702_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK534704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534708_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534710_SHBs_P-B      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MK534727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK818223_SHBs_P-B      MENIASGLLGPLLVLQAGXFLLTKILTIPQSLDXWWTSLSFLGGXPVCLG
MN689117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACLG
MN689118_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MN689119_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MN689120_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MN689121_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
MN689122_SHBs_P-B      MENIASRLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MN689123_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACLG
MN891833_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MN891834_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLRETPVCFG
MT111595_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426101_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGVTPVCPG
MT426102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MT426103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MT426104_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426864_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNLLGGTPVCLG
MT426874_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426890_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426904_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426919_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426935_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426936_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426938_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT426940_SHBs_P-B      MENIASGLLGPLLVLQTGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT426951_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT426961_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426964_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426969_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426970_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426973_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426974_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426976_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MT426979_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTILQSLDSWWTSLNFLGGTPVCLG
MT426982_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426989_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426995_SHBs_P-B      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427005_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427006_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSGWTSLNFLGGTPVCLG
MT427009_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427015_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427018_SHBs_P-B      MENIASGLLGPLLVLQPGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427019_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427029_SHBs_P-B      KENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTAVCLG
MT427032_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427044_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427063_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427064_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427070_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427081_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTNILTIPQSLDSWWTSLNFLGGTPVCLG
MT427105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427107_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427109_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT622522_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGGTPVCLG
MT645001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645005_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645016_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MT645018_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT757436_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757437_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757438_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757439_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT757440_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757442_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757447_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLD
MT757450_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEPPVCLG
MT757455_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGEPPVCLG
MW310261_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW310263_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845288_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFRGETPVCLG
MW845289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGTPVCLG
MW845290_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MW845291_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
MW845292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
MW845294_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETXVCHG
MW845295_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845296_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFQGGTPECRG
MW845298_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MW845299_SHBs_P-B      MENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW845302_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW845303_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845304_SHBs_P-B      MENIASGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845305_SHBs_P-B      MENITSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW845306_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW845310_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
MW845312_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MW847941_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGTPVCLG
MW887648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGETPVCLG
MW999602_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKTLTIPQSLDSWWTSLNFLGETPVCLG
MW999603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW999606_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999609_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999611_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW999614_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MW999615_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999616_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MZ439517_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439520_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439522_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGETPVCPG
MZ439523_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439524_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGETPVCPG
MZ439527_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439528_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439531_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGETPVCPG
MZ439535_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGETPVCPG
MZ439536_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439539_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWISHNFLGETPVCPG
MZ439541_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWISHNFLGETPVCPG
MZ439542_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439543_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439544_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILIIPQSLDSWWTSLNFLGETPVCPG
MZ439545_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILIIPQSLDSWWTSLNFLGETPVCPG
MZ439548_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ671237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675795_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675796_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675799_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934423_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934427_SHBs_P-B      MENIASXLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
MZ934428_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934429_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934437_SHBs_P-B      MENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934439_SHBs_P-B      MENIESELLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM471480_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM471483_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
ON402775_SHBs_P-B      MENIASGLLGPLLLLQAGFFSLTKILTIPQSLDSWWTSLNFVGGTPVCLG
ON402778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
ON402781_SHBs_P-B      MENIASGLLGPLLVLQAGFFWLTKILTIAQSLDSWWTSLNFLGGTPVCLG
X97850_SHBs_P-B        MENIASGLLGHLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPACPG
X98077_SHBs_P-B        MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073846_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB246342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287314_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287315_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB289696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB289730_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB289732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB675676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF397207_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY167089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY596110_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ377158_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448622_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ463788_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ463798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927177_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927200_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927233_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927251_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023860_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621661_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621672_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621678_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621716_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621718_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621782_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ709477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751350_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751399_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751543_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924631_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078862_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079202_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU145102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU451682_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815579_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815581_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815585_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815586_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815588_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815589_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815590_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815591_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815593_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815595_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815596_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815597_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815598_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815609_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815612_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815614_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815684_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815685_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815686_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815687_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815688_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815689_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815691_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815692_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815693_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815694_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815700_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815716_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815719_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815721_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815724_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815725_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815729_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815730_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815737_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815739_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815740_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815742_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652598_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604122_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN792899_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980299_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980305_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341555_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341579_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341609_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801514_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661481_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661483_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661484_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774366_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774375_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774379_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774381_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774384_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774392_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774399_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774408_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774411_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774417_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792685_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792899_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792909_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792984_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793062_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793144_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793165_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC836828_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF053171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173297_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173355_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173356_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803764_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455749_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455780_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455789_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455806_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455809_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455815_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455822_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM875421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148336_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148344_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148345_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148346_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148347_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148579_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659247_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KR232337_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067148_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067182_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067245_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067517_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067591_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067736_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682286_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682287_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682293_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682296_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682297_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682299_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682303_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682307_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682308_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682312_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682315_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682320_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682321_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682323_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682324_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682331_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682335_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682336_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682338_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX765856_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777274_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777293_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777306_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777560_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273157_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273161_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273177_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303070_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303074_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303246_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303248_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303249_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303252_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303423_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303427_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303450_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303452_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316936_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361158_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361160_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361161_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361164_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361192_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361497_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361621_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361624_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361625_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881721_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881724_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881725_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881726_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881727_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881728_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881729_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881730_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881734_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881735_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881740_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881741_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881745_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881752_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881753_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881757_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881759_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881760_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881761_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881846_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881894_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881902_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881903_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881905_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279268_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279269_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279270_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279271_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279272_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC279273_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC677084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF458549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674404_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674480_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674485_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571346_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571349_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571356_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715020_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715077_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715205_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715283_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826166_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826169_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826179_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826202_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK052962_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK052964_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK052965_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK075117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170877_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170998_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171017_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171126_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171188_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534571_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534572_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534573_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534578_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645057_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645058_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW497299_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934426_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934435_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934438_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ934440_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB809526_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801524_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751358_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079300_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JF412801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX978431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF053189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803783_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777543_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073826_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073827_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB073834_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB195933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB219430_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB246339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB471855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF100308_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF100309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121243_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121245_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121246_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF121249_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AF479684_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY167097_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY293309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY518556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738938_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141616_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141617_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141622_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141623_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141632_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141645_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412215_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412218_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448619_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448621_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448623_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448624_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448625_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ448628_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473971_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473975_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU350409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU439018_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU439020_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU522074_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU570070_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU570071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926434_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU926470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927164_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023902_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386582_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386668_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386684_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561019_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621663_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621665_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621670_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621671_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621675_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621677_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621681_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621685_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621689_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621690_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621691_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621694_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621728_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621730_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621732_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621734_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621745_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621793_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751429_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751452_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751461_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751468_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751544_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751577_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ787444_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295536_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377519_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377547_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377566_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377568_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377569_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377588_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377639_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377643_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486559_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924611_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078828_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079284_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU434373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815571_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815619_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815623_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815624_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815632_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815646_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815647_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815650_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815661_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815662_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815663_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815664_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815665_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815666_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815667_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815668_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815669_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815672_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815673_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815674_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815675_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815677_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JF899335_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN406371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650145_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980247_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980294_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980310_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ040125_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ040171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ040173_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341574_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341575_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341578_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341584_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341593_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416185_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416188_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416194_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416196_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416198_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416199_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416200_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416205_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416207_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416302_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416303_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416304_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416306_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416307_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ688405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801507_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292748_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX292754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX429899_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX429900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX429902_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX507210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX507215_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661473_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661474_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX869999_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510642_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510643_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510644_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510656_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510658_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774386_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774394_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792714_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792784_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792795_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792828_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792856_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792872_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792895_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792906_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792993_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793135_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793196_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC836827_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF771928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173345_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173359_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173381_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173399_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173400_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173406_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173408_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173410_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173411_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173412_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173413_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173414_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173415_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173416_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173417_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173422_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173423_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173424_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173425_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410490_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410507_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410516_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410517_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ717792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803787_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM359440_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM392072_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM392083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455607_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455613_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455719_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455737_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455842_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455856_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455866_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148320_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148323_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148326_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148332_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148335_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148359_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148366_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963799_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963802_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963804_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963806_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963809_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963810_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963811_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963812_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963813_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963828_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963829_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963831_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963832_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963834_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963835_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963837_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963840_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963841_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963961_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963964_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963965_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963966_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963969_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963971_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963973_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963974_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963975_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963981_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963982_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963983_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963984_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963985_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963988_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963989_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067398_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067435_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067482_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067525_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067593_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067658_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067679_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067715_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067717_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067778_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372111_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372112_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX621055_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777376_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777546_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777555_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777561_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777565_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777567_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777571_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777574_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777575_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777577_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273143_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273147_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273148_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273149_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273150_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273151_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273154_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273159_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273160_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273169_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273174_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273179_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273181_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273186_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273188_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302963_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302965_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302968_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303002_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303212_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303214_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303218_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303273_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303276_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303278_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303280_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303281_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303346_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303350_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303355_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303358_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303365_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303396_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303399_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303404_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303414_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303422_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303425_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303433_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303435_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303446_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303453_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303459_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303461_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316931_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316956_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360433_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360434_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360439_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360440_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360442_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360446_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360485_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360491_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360492_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360494_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360495_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360497_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360501_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360505_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360507_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360512_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360513_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360515_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360518_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360522_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360529_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360530_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360533_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360534_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360535_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360539_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360540_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360541_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360545_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360547_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360551_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360593_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360596_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360598_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360602_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360611_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360656_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360660_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360662_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360664_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360665_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360667_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360671_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360672_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360673_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360674_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360684_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360685_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360686_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360687_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360721_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360722_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360726_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360728_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360730_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360736_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360739_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360740_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360744_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360745_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360747_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360748_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360749_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360752_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360753_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360755_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360757_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360867_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360922_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360923_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360925_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360926_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360927_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360936_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360938_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360939_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360940_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360941_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360945_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360951_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360955_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361028_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361033_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361035_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361068_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361098_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361106_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361165_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361242_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361458_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361459_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361460_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361463_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361465_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361475_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361502_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361503_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361518_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361580_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361582_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361585_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460011_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460012_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470961_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470962_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349873_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349878_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC416037_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
M54923_SHBs_P-B        MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674427_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674449_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674450_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG383599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714930_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714939_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714958_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715014_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715024_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715114_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715132_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715174_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715194_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715244_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715267_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715274_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715299_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715301_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826185_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826186_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826189_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826194_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826196_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826197_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826198_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826200_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826204_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826205_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826208_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826214_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH061283_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170884_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170901_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170980_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170983_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170995_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171169_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534575_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426859_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426860_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426861_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426862_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426867_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426868_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426869_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426870_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426871_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426872_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426873_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426876_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426877_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426878_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426879_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426880_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426881_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426882_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426883_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426884_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426885_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426886_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426887_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426888_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426891_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426892_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426893_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426894_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426895_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426896_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426897_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426898_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426899_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426901_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426902_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426903_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426905_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427016_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427017_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427022_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427024_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427025_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427026_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427030_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427033_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427034_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427036_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427037_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427038_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427039_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427040_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427041_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427042_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427043_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427045_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427047_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427048_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427049_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427050_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427051_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427052_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427054_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427055_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427057_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427058_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427059_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427060_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427061_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427062_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427065_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427066_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427068_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427069_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427072_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427074_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427075_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427076_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427077_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427078_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427079_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427080_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427086_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427091_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427099_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427104_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427108_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645025_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT645041_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845293_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845308_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999607_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ671236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ671239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675786_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OK106254_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM688314_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM688316_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621656_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650150_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650195_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF741887_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993680_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993683_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993685_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
LC349877_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774378_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774385_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173353_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455810_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067276_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777544_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360891_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715023_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534581_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ562240_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302924_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303245_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361157_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993686_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCPG
AB195935_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AP011087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011090_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ141652_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023850_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023925_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023987_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751615_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295538_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358138_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358142_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358145_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358149_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358151_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924635_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924640_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801512_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173402_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148375_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148378_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148379_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148384_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148388_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148389_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148392_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148394_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148396_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148399_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273144_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360688_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360689_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360694_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360697_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360701_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360705_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY629636_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB287317_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY596112_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ463792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN980240_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792772_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM455798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KR152339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY316926_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY596106_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
DQ463793_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU796066_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN980236_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ801506_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792823_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793007_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621693_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067770_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253413_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738929_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738930_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023635_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621748_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ325794_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652507_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652508_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652511_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652512_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652513_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652516_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652517_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652518_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652520_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652521_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604223_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341588_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372114_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674384_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674410_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674453_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674488_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674490_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674497_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674509_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW768085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW768087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW847940_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
X75660_SHBs_P-B        MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253410_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738927_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023632_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023715_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023718_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023723_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023724_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023729_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023762_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023763_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023767_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023770_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023771_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023772_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023810_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023811_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023835_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023842_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023853_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023857_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023862_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023867_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023869_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023870_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023876_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023888_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023895_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023905_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023916_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023921_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023923_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023941_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023950_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023953_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023958_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023959_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023962_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023965_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023970_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023971_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023973_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023974_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023975_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023976_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023978_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023981_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023982_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023983_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023984_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023986_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023992_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023993_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023995_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023996_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023998_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023999_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024000_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024004_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024005_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024006_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024008_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024010_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024012_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024014_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024015_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024016_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024017_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024020_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024029_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024036_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024038_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024045_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ349236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822055_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822056_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822058_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822062_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822068_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822083_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822086_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822087_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822097_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652206_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652208_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652215_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652217_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652218_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652220_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652226_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652242_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652245_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652246_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652247_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652251_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652253_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652257_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652259_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652260_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652261_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652262_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652264_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652265_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652266_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652267_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652270_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652271_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652281_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652283_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652286_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652296_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652302_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652304_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652305_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652307_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652308_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652310_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652312_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652331_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652335_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652337_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652338_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652343_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652344_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652361_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652366_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652375_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652377_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652378_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652380_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652384_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652385_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652386_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652388_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652390_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652392_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652414_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652415_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652416_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652417_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652418_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652424_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652425_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652430_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652433_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652436_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652437_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652438_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652439_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652440_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652441_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652444_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652445_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652446_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652448_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652449_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652452_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652475_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652479_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652480_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652482_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652496_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652497_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652501_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652504_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652505_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652527_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652528_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652531_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652533_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652534_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652536_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652537_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652540_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652550_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652551_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652553_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652555_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652557_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652559_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652560_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652561_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652562_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652563_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652565_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652566_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652584_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652587_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652590_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652591_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652592_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652593_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652596_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652597_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652614_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652616_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652617_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652619_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652624_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652626_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652631_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652632_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652635_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652636_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652639_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652642_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652643_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652644_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652646_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652650_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652653_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652676_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652678_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652777_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652783_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652785_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652789_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652793_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652802_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652820_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604125_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604154_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604284_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455779_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674394_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674400_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674413_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674423_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674431_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674432_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674433_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674443_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674452_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674455_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674482_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674495_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674498_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674500_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674510_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674511_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674515_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674487_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB253616_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659219_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KJ717796_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621794_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792944_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU963987_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303306_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303307_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303308_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303434_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303458_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361040_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361041_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361042_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AF121244_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306700_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306701_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306702_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939663_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386584_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621713_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751280_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751398_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751451_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078792_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079320_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815551_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815552_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815553_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815555_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815556_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815559_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815560_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815564_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815565_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815566_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815567_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815568_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815576_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650171_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416174_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661482_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX870001_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792687_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792766_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792893_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455699_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148318_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964164_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067255_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777551_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777559_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777564_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777572_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273158_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273163_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273187_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303275_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303302_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303403_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303408_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303415_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303460_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360474_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360477_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361055_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460067_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460069_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460072_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460074_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470830_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470833_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714961_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715026_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715029_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715134_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715241_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826184_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826211_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AB302943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AB302944_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
EU926448_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980378_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316917_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927191_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751392_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510650_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360359_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621704_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510657_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067594_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273182_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303438_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826191_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW999610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY217360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815715_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815726_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815728_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815734_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815736_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815738_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815744_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815745_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815746_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774410_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067668_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361703_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY738935_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067704_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303216_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360607_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360724_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361240_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427028_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
X97851_SHBs_P-B        MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652278_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AP011092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330996_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358148_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845301_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY163870_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ993710_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGETPVCLG
FJ743728_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792664_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KC792971_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KM875420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171075_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
AY217357_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY217358_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751308_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU158263_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774396_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM392084_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170866_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171030_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
AY517619_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU919175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU919176_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792667_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621634_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751275_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751403_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751547_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ751590_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN980317_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793010_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KM455747_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964124_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964125_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964126_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964127_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964128_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964129_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964130_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964131_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964133_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964134_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MG715019_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171104_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
AY800392_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCHG
EU882002_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173398_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360633_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360634_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360635_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360637_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360639_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360640_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360643_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360649_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360650_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ416191_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC492739_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715109_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534658_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534683_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534693_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534696_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534733_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM688315_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473973_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815706_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815707_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980326_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148338_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH932712_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473974_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPEGLG
GQ486494_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170927_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173386_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360326_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473976_SHBs_P-B      MENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EF473977_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ173365_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173366_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302929_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303099_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303264_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303267_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303268_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303270_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303271_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361110_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361114_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361118_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361119_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361122_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361125_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361126_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361128_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361129_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361474_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964101_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964102_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964104_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964107_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148357_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023813_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486584_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
EU926465_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412212_SHBs_P-B      MENIASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815548_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815558_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815562_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815563_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815572_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815575_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ416169_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK170990_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MK171159_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ486645_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715172_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN792895_SHBs_P-B      MENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGGTPVCLG
JN792897_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN792898_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
JN792893_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCLG
KX682309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682313_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682316_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682327_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682301_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX682304_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX682306_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX682285_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KX682290_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KX682294_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
KX682300_SHBs_P-B      MENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCRG
EU131125_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139543_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139534_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139535_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139537_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139538_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139539_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU139542_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306681_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306680_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU306707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330990_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU330999_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU331001_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU522075_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751587_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302938_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302941_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303251_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361163_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ561021_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751493_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316950_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386654_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751462_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN295535_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ486397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078853_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604124_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980248_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980319_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792981_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM875416_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM875417_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963968_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067362_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067706_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777273_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361168_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571360_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171103_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU927156_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
FJ621674_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621720_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751285_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751592_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604134_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC510651_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793089_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067429_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303426_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571374_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715229_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH663473_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ671238_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU939665_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621682_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621695_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621707_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067283_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY697837_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715304_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661475_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360715_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534602_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924628_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC792918_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG826183_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FJ621614_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ621807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924637_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ924648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
GU815557_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY360750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
LC349869_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT427046_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT427056_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT427085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ899785_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLG
FJ899786_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETLVCLG
MW999612_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ899790_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ899791_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674513_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675794_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675797_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675804_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675806_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675807_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023773_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674461_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023911_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024022_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821889_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652313_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652314_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652315_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652317_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652318_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652320_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652323_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652326_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652454_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652455_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652457_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652458_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652462_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652465_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652466_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652467_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652468_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652469_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652481_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652483_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652484_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652486_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652487_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652488_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652489_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652490_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652491_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652492_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652493_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652494_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652763_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652768_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652770_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652776_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148371_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023930_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ023940_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652571_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652572_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652574_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652575_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652577_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652578_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652581_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652582_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ024042_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ032354_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777554_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621743_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273190_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303440_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303447_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303464_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715095_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621645_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FJ561018_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406269_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY303309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361043_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX276809_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GU815640_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170982_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777336_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826195_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358150_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460049_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460053_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621783_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621784_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774405_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173376_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777550_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302940_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303366_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303367_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303368_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360914_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360916_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360917_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360918_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360920_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358147_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377625_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
GQ377638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KU963978_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KU963986_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KM455601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ358136_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ924632_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360452_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360509_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427067_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621669_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715044_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715324_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621736_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067471_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777569_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426906_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426907_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426908_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426909_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426911_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426912_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426914_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426916_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426917_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426918_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426921_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426922_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426923_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426925_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426926_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426929_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426932_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426933_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426934_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426939_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426943_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426944_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426945_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426947_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426949_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426953_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426955_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426957_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426958_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426960_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426962_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426963_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426966_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426967_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426968_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426975_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426978_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426981_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426983_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426986_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426987_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426988_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426992_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426997_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426998_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426999_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427000_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427002_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427003_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427004_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427007_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427010_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427011_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427012_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427014_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173363_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173364_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173418_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173419_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360449_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360453_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360459_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360463_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360465_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980275_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826207_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170857_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621724_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534554_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372110_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571328_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571344_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777373_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173421_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360468_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360478_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360480_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360481_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360482_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361515_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU078808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ717835_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ803819_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX621088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KX621117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG826181_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171117_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK171138_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
GU079445_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963962_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963963_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715016_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826193_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751413_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980230_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980254_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ621805_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751473_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX777570_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715031_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751467_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751503_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751512_SHBs_P-B      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM213035_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
FN295502_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881781_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881782_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881783_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881784_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881786_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881788_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881789_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881790_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881793_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881798_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881800_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881801_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FR821805_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
FR821806_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
FR821807_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652159_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652162_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652163_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652164_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652167_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652169_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652170_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652171_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652173_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652136_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822164_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN604143_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674437_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674493_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652229_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652233_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652280_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652294_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652370_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652525_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652795_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652256_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HE652648_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486501_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652372_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652427_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652554_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652585_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652788_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845300_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652544_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652804_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774398_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC793179_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173342_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316921_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652609_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652411_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652798_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822159_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652836_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652838_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652839_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652841_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652842_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652844_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652845_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652846_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652849_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652850_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652853_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652856_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652860_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652861_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652862_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652863_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652291_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173369_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303254_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303260_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360549_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361131_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361132_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361133_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361134_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361135_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361136_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361137_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361140_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361146_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406263_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406272_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964080_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360462_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG714948_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173387_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173388_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360333_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360334_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360335_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360337_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360341_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360343_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360344_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360351_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360352_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273155_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303400_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360719_SHBs_P-B      MENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792938_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF674460_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652453_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341581_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGXTPVCLG
KX777272_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406257_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JQ416165_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ027329_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX661478_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173347_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303220_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303223_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361207_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361209_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361210_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361213_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361216_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361217_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361218_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN980355_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX372106_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964167_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079457_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682284_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682291_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682295_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682298_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682302_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682305_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682310_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682314_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682318_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682326_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682334_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
KX682340_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTPVCLG
GU815569_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815577_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
GU815578_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCRG
GU815681_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360353_SHBs_P-B      MENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815627_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815628_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815629_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815630_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815631_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815636_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815637_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815638_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815641_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815642_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815645_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815622_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303311_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLG
KY361045_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPMCLG
GU815621_SHBs_P-B      MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF053163_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803756_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826212_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148330_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815702_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360355_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815748_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815750_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815751_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815753_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815755_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815757_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815759_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815760_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815762_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815765_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815766_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815767_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815768_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815769_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815771_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273183_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303442_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815764_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815776_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815781_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU815782_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652204_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652158_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652178_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652179_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652180_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652182_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652184_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652185_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652186_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652189_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652191_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652193_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652194_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652195_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652196_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652200_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
HE652205_SHBs_P-B      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCRG
MF674499_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674507_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652428_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652299_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652422_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652420_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652640_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652659_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652586_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652567_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
HE652749_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652753_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652754_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652759_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652764_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ027331_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792735_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715013_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171025_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ341599_SHBs_P-B      MENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426875_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ801479_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY303226_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361222_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303465_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY316915_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707737_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707738_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707742_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707743_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707744_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707745_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707746_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707750_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707753_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707758_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707759_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707763_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707765_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707766_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707762_SHBs_P-B      MENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148413_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148415_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148423_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148425_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148430_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ717831_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW310262_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX869998_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX067565_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774404_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455671_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM471476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK171053_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC792678_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MK534608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715223_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC793180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KP148322_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX276808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455734_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303284_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303287_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303291_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY316932_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361071_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361074_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361075_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361078_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KF053165_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803755_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803758_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406260_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KX067327_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803768_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGETPVCLG
KF053182_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ803773_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ803775_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KJ803784_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803786_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803763_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KJ803781_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011546_SHBs_P-B      MENIASGLLGHLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011548_SHBs_P-B      MENIASGLLGPLIVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ011549_SHBs_P-B      MENIASGLLGPLIVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY303230_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303232_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361197_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361199_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361201_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361203_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360944_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361170_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715051_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845307_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361230_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361232_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361545_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY273145_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803789_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLNFLGETPVCLG
KJ803795_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803796_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803797_SHBs_P-B      MENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803801_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGIPVCLG
KJ803805_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGVPPVCLG
KJ803808_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803816_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEKLVCPG
KJ803820_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ803821_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNSLGETPVCPG
KJ803824_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPACLG
KJ803825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KP406275_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNFLGETPVCLG
MK534603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455790_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303286_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY316925_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361073_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361079_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361616_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KP148349_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361516_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148385_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148386_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148401_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK534634_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148398_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148433_SHBs_P-B      MENISSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148418_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148432_SHBs_P-B      MENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148426_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148427_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148456_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148459_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148461_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406165_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406172_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406173_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
KP406177_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406178_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406180_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406181_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406182_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406183_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406184_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406185_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406186_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406187_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406188_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406189_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406191_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406192_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406193_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406195_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406196_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406197_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406198_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406199_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406200_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406201_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406202_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406203_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406204_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406205_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406206_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406207_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406208_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406209_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406210_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406211_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406213_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406214_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406215_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406217_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406218_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406219_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406190_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406212_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406216_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406222_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406223_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406225_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406226_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406229_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406230_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406231_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406232_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406233_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406234_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406235_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406236_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406239_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406241_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406242_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406243_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGTPVCLG
KP406240_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRNLDSWWTSLNFLGGTPVCLG
KP406246_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406248_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406249_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406252_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406254_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406251_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406270_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406259_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKALTIPQSLDSWWTSLNFLGETPVCLG
KP406261_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKALTIPQSLDSWWTSLNFLGETPVCLG
KP406273_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKALTIPQSLDSWWTSLNFLGETPVCLG
KU964093_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303349_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360954_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406282_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406283_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406285_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406287_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406289_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406292_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406293_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406291_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406294_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406306_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406307_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406308_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406309_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406310_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406313_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406315_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406316_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406317_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406290_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406299_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406300_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406304_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406305_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406312_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406314_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406302_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KP406319_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406320_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406321_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406322_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406323_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406324_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406325_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406326_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406328_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406329_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406334_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406333_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP406335_SHBs_P-B      MENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP659228_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KP659229_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KR818868_SHBs_P-B      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
MF674483_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963817_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963818_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963819_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963820_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963821_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963822_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963823_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963824_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963825_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963826_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963827_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963843_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963844_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963845_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963846_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963847_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963848_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963849_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963850_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963851_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963852_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963853_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963947_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963950_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963952_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963953_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963954_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963956_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963957_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963958_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963959_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963955_SHBs_P-B      METIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU963977_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KU964081_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964085_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964086_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964089_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964090_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964091_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964097_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964099_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964100_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964105_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964106_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964109_SHBs_P-B      MENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964112_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964113_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964114_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964116_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964119_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964121_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964122_SHBs_P-B      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MW310264_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964140_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964142_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964144_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964145_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964147_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964148_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964150_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964151_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964149_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGGTPVCLG
KU964157_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964168_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964160_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGETPVCLG
KU964165_SHBs_P-B      MENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964251_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964253_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964254_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964247_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964249_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964394_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964255_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964256_SHBs_P-B      MENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964252_SHBs_P-B      MENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964270_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KU964261_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964262_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964263_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964264_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964266_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964268_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964271_SHBs_P-B      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964273_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964274_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964275_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964276_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964277_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964278_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964279_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964281_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964284_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964285_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KU964288_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964289_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964290_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964292_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964294_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964295_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964296_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964297_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964298_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964299_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964301_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KU964382_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964383_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964384_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964385_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964388_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964391_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964393_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964395_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU964397_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682317_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682325_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682330_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682332_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682337_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX682339_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303348_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360953_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674503_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303398_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303401_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303407_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303409_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEIPVCPG
KY303410_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY303411_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPRSLDSWWTSLNFLGETPVCPG
KY303412_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KY303413_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY470956_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303416_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY303417_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303418_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY303424_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303445_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303462_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY303466_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
KY303467_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
KY361149_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361152_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361153_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361156_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303253_SHBs_P-B      IENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361139_SHBs_P-B      IENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460045_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303262_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361120_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360950_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY302964_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303356_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360932_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361581_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360904_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360906_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360907_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360909_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360913_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460104_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361029_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303305_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLSFLGGTPVCLG
KY361039_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLSFLGGTPVCLG
KY303027_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361708_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361609_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361610_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361612_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361614_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361615_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303067_SHBs_P-B      MENIASGLLGPLLVLQAGFVLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361618_SHBs_P-B      MENIASGLLGPLLVLQAGFVLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361598_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303076_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361599_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460085_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460086_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460088_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460091_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460092_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460094_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361520_SHBs_P-B      MENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361467_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303093_SHBs_P-B      MENIASGLLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361468_SHBs_P-B      MENIASGLLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361214_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGRTPVCLG
KY303219_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361215_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY361193_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303227_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361194_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361583_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361542_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361540_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361541_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFLGETPVCLG
KY361543_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY360682_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361522_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361524_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361525_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361526_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361527_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361504_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361505_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361506_SHBs_P-B      MENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361512_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY361681_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361682_SHBs_P-B      MESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361683_SHBs_P-B      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361709_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361710_SHBs_P-B      MENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361711_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361712_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTTVCLG
KY361714_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEGTPVCLG
KY361715_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLIFLGGTTVCLG
KY361717_SHBs_P-B      MENIASGLLGLLLVLQAGFFLLTKILTIPQSLDSWWASLNFLEGTPVCLG
KY361620_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361622_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361623_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303079_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303080_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY303082_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361600_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361602_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361603_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361605_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826175_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361601_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361604_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361607_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361608_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361469_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361470_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361472_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361473_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361476_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361233_SHBs_P-B      MENITSGLLGPVLVLQAGFFLLTKILTIPQSLDTWWTSLNFLGGTPVCLG
KY361235_SHBs_P-B      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTLVCLG
KY361237_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361241_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361220_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361221_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361195_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361196_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCFG
KY361198_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361200_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361202_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTPLNFLGGTPVCLG
KY361177_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361178_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKIFTIPQSLDSWWTSLNFLGGTPVCLG
KY361179_SHBs_P-B      MENIASGLLGLLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361180_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361181_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361182_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361159_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPACLG
KY361162_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361141_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361143_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSPDSWWTSLNFLGGTPVCLG
KY361144_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361147_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361121_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361124_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGKPVCLG
KY361127_SHBs_P-B      MENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361130_SHBs_P-B      VENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361099_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360742_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361102_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361104_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361072_SHBs_P-B      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGETPVCLG
KY361076_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MG826174_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361077_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY361053_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGGTPVCLG
KY361044_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPMCLG
KY360952_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360956_SHBs_P-B      MENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360958_SHBs_P-B      MENIASGLLGPLLVLQAGFILLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360959_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPGCLG
KY360935_SHBs_P-B      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTPLNFLGGTPVCLG
KY360919_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360921_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361698_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEETTVCLG
KY303457_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY316935_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
KY360661_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361466_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427053_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY360606_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCPG
KY360734_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSPDSWWTSLNFLGGTPVCLG
MZ675785_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361462_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361051_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361150_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361514_SHBs_P-B      MENTTSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGTPVCLG
KY361571_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY361597_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460025_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470832_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGGTPVCLG
KY470840_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGGTPVCLG
KY460098_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY460101_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470837_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY470841_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881828_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881829_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881837_SHBs_P-B      MENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KY881862_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881896_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881914_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881866_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881868_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881854_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881855_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881858_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881859_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881860_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881895_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881897_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881898_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881899_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881900_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881901_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881906_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881908_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881909_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881910_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881947_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881949_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881950_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881951_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881953_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881956_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KY881958_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG571373_SHBs_P-B      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715096_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF674456_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845286_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MW845311_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MF682487_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG715098_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG738747_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG738749_SHBs_P-B      ----ASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826223_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPECLG
MG826224_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MW845297_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
MZ934430_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK170988_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MW845309_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426865_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNLLGGTPVCLG
MT426866_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNLLGGTPVCLG
MT426920_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426924_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426927_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426928_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426930_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426941_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426942_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426950_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426959_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426985_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426991_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426993_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426994_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426996_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT426931_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426937_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426946_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426971_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426972_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426977_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT427008_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426980_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426984_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT426990_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSHNFLGGTPVCLG
MT427020_SHBs_P-B      MENIASGLLGPLLVLQPGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427035_SHBs_P-B      MENIASGLLGPLLVLQPGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
OM930731_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT427106_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MT757444_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757445_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757449_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757448_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT757451_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT757453_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT757457_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
MT757441_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757443_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757446_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757454_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757456_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MT757452_SHBs_P-B      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
MZ439518_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439519_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439521_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439525_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439526_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439530_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439534_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439537_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCPG
MZ439529_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGETPVCPG
MZ439532_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439538_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439540_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439546_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439551_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439533_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGEKPVCPG
MZ439549_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWISHNFLGETPVCPG
MZ439547_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWISHNFLGETPVCPG
MZ439550_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILIIPQSLDSWWTSLNFLGETPVCPG
MZ675800_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675803_SHBs_P-B      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675801_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MZ675802_SHBs_P-B      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
                                              .                          

KU964139_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLFLIFLLVLLDY
JN980249_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB010289_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB010290_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB010291_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB010292_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB014366_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDY
AB030509_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB031266_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB031267_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB033554_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB033555_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB048705_SHBs_P-B      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB073821_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073822_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073823_SHBs_P-B      QNLQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073824_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073825_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073828_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073829_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073830_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073831_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073832_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB073833_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073835_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB073836_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073837_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073838_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073839_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073840_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073841_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073842_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073843_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073844_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
AB073845_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073847_SHBs_P-B      RNSQSQISSHSPISCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
AB073848_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073849_SHBs_P-B      QNSQCQISSHSPTFCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073850_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073851_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRLMCLRRFIIFLCILLLCLIFLLVLLDY
AB073852_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073853_SHBs_P-B      QNSQCQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073854_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDY
AB073855_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073856_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073857_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB073858_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB100695_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB106884_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDY
AB115551_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB117759_SHBs_P-B      QNSQSQIFSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB195934_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB205119_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB205120_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB205121_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB205122_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB212625_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB212626_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB219426_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB219427_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
AB219428_SHBs_C-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB219429_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDF
AB231909_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB232112_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB232506_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB232519_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB241116_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB241117_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB246340_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB246341_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB246343_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253402_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253403_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253404_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253405_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253406_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253414_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253608_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253609_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253610_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB253613_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB253614_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253617_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253618_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253619_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253621_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB253622_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287316_SHBs_P-B      PNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287318_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287319_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287320_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB287321_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287322_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287323_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
AB287325_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
AB287326_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287327_SHBs_P-B      QNSQSPISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB287329_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB289695_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB289713_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB289738_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB300364_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB300370_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
AB300371_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB302095_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB302942_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB302945_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB362933_SHBs_P-B      QNSQFQISNHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB365441_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB365445_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB368295_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB471854_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB493827_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB493833_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB493835_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB555498_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB555499_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
AB642093_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB642094_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB642101_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDY
AB713527_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB713528_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB713529_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB713530_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB713531_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB809488_SHBs_P-B      QNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLALLDS
AB809524_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
AB809529_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB809552_SHBs_P-B      QNSQCQISSHSPTFCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB828708_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900095_SHBs_P-B      QNSQSQICSHLPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900096_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900097_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLALLDY
AB900098_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900102_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900103_SHBs_P-B      QNSQSQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900104_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900105_SHBs_P-B      QNSQCQISSHSPTCCPPTCPGYXWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900106_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
AB900107_SHBs_P-B      QNSQSPISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900108_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB900110_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AB900111_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDY
AB900112_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AB931168_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
AB931169_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF013629_SHBs_P-B      QNSQSQISSHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF013630_SHBs_P-B      QNSQSQISSHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF061527_SHBs_P-B      QNSQSQISSHSPSCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF121247_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF121248_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF121250_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF121251_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
AF279464_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF282917_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF282918_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF411291_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRLIIFLCILLLCLIFLLVLLDY
AF415217_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AF461360_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AJ297873_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AJ627225_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011084_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011086_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011089_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011091_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011093_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AP011094_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY033072_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY033073_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY163869_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AY167093_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY167094_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY167098_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY167100_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY167101_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY167102_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY206373_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLVDY
AY206375_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
AY206383_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AY206387_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDF
AY206390_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY206391_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AY217355_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY217356_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY217359_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY217362_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY217368_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY220697_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY220698_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
AY220703_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY220704_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY517489_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY596102_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY596103_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY596104_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
AY596105_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY596109_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY596111_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY738926_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY738928_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY738931_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY738932_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY738936_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738937_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLIFLLVLLDY
AY738939_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY766463_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY800389_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
AY800391_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D00329_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D00330_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D00331_SHBs_C-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D23678_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D23679_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D50521_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
D50522_SHBs_P-B        QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141615_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141618_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141619_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141621_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMGLRRFIIFLCILLLCLIFLLVLLDY
DQ141624_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141626_SHBs_P-B      QNSQSQISSHSPTWCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
DQ141628_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141630_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141631_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141634_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141635_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141637_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141638_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141639_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLSLIFLLVLLDY
DQ141640_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141641_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ141642_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ141643_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
DQ141644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ141646_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141647_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141648_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141649_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVPLDY
DQ141650_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLMFLLVLLDY
DQ141651_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLFLIFLLVLLDY
DQ141653_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141654_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ141655_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ361535_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412176_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412177_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412178_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412179_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRXIXFLCILLLCLIFLLALLDY
DQ412180_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412181_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412182_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
DQ412183_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLALLDY
DQ412184_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412185_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412186_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ412188_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412189_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412190_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412191_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ412192_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412193_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412194_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412195_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412196_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412197_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412198_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412199_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412200_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLGLLDY
DQ412201_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
DQ412202_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412203_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
DQ412204_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412205_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDY
DQ412206_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412207_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412208_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412209_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDF
DQ412211_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412213_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412214_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412216_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412217_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412220_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412221_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412222_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
DQ412223_SHBs_P-B      QNSQSQTSSHSPTCCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
DQ412224_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412225_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ412226_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412228_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463787_SHBs_P-B      QNSQFQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
DQ463789_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
DQ463790_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLILLLVLLDY
DQ463791_SHBs_P-B      QNSQSQICSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLALLDY
DQ463794_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463795_SHBs_P-B      QNSQFQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
DQ463796_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYHWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463797_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLYLIFLLVLLDY
DQ463799_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463800_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463801_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ463802_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCHIFLLVLLDY
DQ904357_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ993681_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ993682_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
DQ993684_SHBs_P-B      QNSQSQISSHSPTCCPPDCPGYPRMCLRGFIIFLCILLLCLIFLLVLLDY
DQ993687_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ993696_SHBs_P-B      QNSQSPISSHSPTCCPPICPDYPWMCLRRFIIFLCILLLCLIFLMVLLDY
DQ993698_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ993699_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ993700_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ993701_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ993702_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLIFLLVLLDY
DQ993705_SHBs_P-B      QNSQSHISSHSPTCCPPICPGYRWMCLPRFIIFLCILLLCLIFLLVLLDY
DQ995801_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMSLRRFIIFLCILLLCLIFLLVLLDY
DQ995802_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRRMCLRRFIIFLCILLLCLIFLLVLLDY
DQ995804_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EF134945_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EF134946_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EF494380_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
EF494381_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLICLLGLLDY
EF494382_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU075308_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131110_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
EU131112_SHBs_P-B      QNSQSQISSHSPIYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDL
EU131113_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131114_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131115_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
EU131117_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131118_SHBs_P-B      QNSQSQISSHSPIYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDL
EU131119_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131120_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131121_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131123_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131124_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131126_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
EU131127_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU131128_SHBs_P-B      QNSQSQISSHSPIYCPPICPGYRWMCLRRFIIFLRILLLCLIFLLVLLDL
EU131129_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
EU131130_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU139529_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU139533_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
EU158262_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU305547_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU305548_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306678_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306679_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306696_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306699_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306703_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWLCLRRFIIFLCILLLCLIFLLVLLDY
EU306704_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306705_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU306711_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU330989_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU330994_SHBs_P-B      QNSQSQISGHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU330995_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU330998_SHBs_P-B      QNSQSQISSHSPTCCPPICPGCRWMCLRLFIIFLCILLLCLIFLLVLLDY
EU331000_SHBs_P-B      QNSQSQISSHSPTCCPPICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU439021_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU439022_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU439023_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU487256_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU487257_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU522066_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU522067_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU522072_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU522073_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCTLLLCLIFLLVLLDY
EU547563_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU564822_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU564823_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU564824_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU564826_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU570075_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU579441_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU589335_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU595031_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU660224_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU660231_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
EU660233_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU796067_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU796068_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU881997_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
EU881998_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDC
EU882003_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU882004_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU915485_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU919171_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU919172_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU919173_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU921791_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU921794_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926432_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926436_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926437_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926443_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926450_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926455_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926460_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLVDY
EU926462_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926464_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926471_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU926473_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927155_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927181_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927187_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU927189_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927190_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927192_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927198_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU927201_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927215_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
EU927216_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927220_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927223_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927224_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927226_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927231_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927235_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927242_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927243_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927244_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927247_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927272_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU927284_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939559_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939634_SHBs_P-B      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939635_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
EU939636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU939637_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU939638_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939639_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939660_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939661_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939664_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
EU939666_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939667_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939669_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU939670_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939671_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939672_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939673_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939674_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939675_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
EU939676_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939677_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939678_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
FJ023631_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023634_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023637_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023638_SHBs_P-B      QNSQSPISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023697_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023739_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023741_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023743_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023746_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023749_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023776_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023797_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023801_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023814_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023816_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023829_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023830_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023831_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023832_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
FJ023846_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023855_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIISLCILLLCLIFLLVLLDY
FJ023858_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023871_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023873_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023893_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023899_SHBs_P-B      QSSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023900_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023903_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023909_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023913_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023918_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023919_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023924_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023934_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023951_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023963_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023964_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023989_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ023990_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024018_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024019_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024027_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024030_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024032_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024033_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ024040_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024041_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024044_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ024046_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032342_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032344_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032349_SHBs_P-B      QNSQSQISSHSSTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032352_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032353_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ032357_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ032358_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386600_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDY
FJ386608_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386610_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386615_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDY
FJ386642_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386648_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386655_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386656_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386658_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386666_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386669_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386675_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386676_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386680_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386681_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386682_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386683_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386688_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ518812_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ560992_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ560995_SHBs_P-B      QNSHSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ560996_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561001_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561007_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561009_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561013_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561015_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
FJ561024_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561027_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561038_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ561044_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562219_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562222_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562224_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLISLLVLLDY
FJ562231_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562234_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562236_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562237_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ562246_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ562253_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ562254_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562257_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562259_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562260_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ562262_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562289_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
FJ562296_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562303_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDY
FJ562311_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562312_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562316_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFILFLCILLLCLIFLLVLLDY
FJ562321_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ562322_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621592_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621602_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621603_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621606_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621607_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621608_SHBs_P-B      QNSQSPISXHSPTXCPPICPGYRWMCLRRFIXFLXILLLCLIFLLVLLDY
FJ621612_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621613_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
FJ621615_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621616_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRSMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621617_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621618_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621620_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621622_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621623_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621624_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621625_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621626_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621627_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621628_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621630_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621631_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621632_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621635_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621637_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621638_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621639_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621640_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621641_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621642_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
FJ621643_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621646_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621647_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621649_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621650_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621651_SHBs_P-B      PNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621652_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621653_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621654_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621655_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621657_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621658_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621659_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621660_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621662_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621664_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621666_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621667_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621668_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621673_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621683_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621684_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621686_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLXVXXDY
FJ621687_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621688_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621692_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621699_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621700_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621701_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621706_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621708_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621712_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621714_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621715_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621719_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621721_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621722_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621723_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621725_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621726_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621727_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621729_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621731_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621735_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621737_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621738_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621739_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621740_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621741_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621742_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
FJ621744_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621746_SHBs_P-B      QNSQSQISSHSPTFCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621747_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621749_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621751_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621752_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621753_SHBs_P-B      QNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621754_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621755_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621756_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621757_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621758_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621759_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621761_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621762_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621763_SHBs_P-B      QNSQSPISSHSPTCCPPTCPGYRWMFLRRFIIFLCILLLCLIFLLVLLDY
FJ621764_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621768_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621769_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621770_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621771_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621772_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621773_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621774_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621775_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621776_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ621777_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621778_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621779_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621780_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621781_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621785_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621786_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621787_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621788_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILXLCLIFLLVLLDY
FJ621789_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDY
FJ621790_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621791_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
FJ621795_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621796_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621797_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621801_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621802_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621803_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621804_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621806_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ621809_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ709490_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ743737_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751273_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751276_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751278_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
FJ751283_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751288_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751293_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751296_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDY
FJ751299_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751307_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751312_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLPCLISLLVLLDY
FJ751314_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751317_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751347_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751356_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
FJ751359_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751366_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751369_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751376_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751389_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751390_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751391_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751400_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751402_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751406_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751407_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751408_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751411_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751415_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751416_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751435_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751450_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751453_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMFLRRFIIFLCILLLCLIFLLVLLDY
FJ751466_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751469_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751471_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751479_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751480_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751482_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751490_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751495_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751498_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751504_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751505_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751508_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751509_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751511_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751518_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751522_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751523_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751526_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751530_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751531_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751535_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751537_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751555_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751556_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751566_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751571_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751579_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751585_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751595_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
FJ751610_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751612_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ787475_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ787477_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRLMCLRRFIILLCILLLCLIFLLVLLDY
FJ899779_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRLIIFLCILLLCLIFLLVLLDY
FJ899784_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ899787_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ919933_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ919934_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
FM200206_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYHWMCLRRFIIFLCILLLCLIFLLVLLDY
FN295499_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FN295522_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FN295539_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821800_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
FR821801_SHBs_P-B      QNSQSPISNHSPTSCPPTRPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
FR821803_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821804_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821808_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821809_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821817_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRIIIFLCILLLCLIFLLVLLDY
FR821844_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821892_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821902_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821906_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821911_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821914_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821928_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLWRFIIFLCILLLCLIFLLVLLDY
FR821937_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDS
FR821940_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDS
FR821972_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821975_SHBs_P-B      QNSQSQISSRSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821978_SHBs_P-B      QNSQSQISSHSPTCCPPICPGCRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822020_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822021_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822032_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822044_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822060_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822063_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822065_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822070_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822071_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822072_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR822080_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822084_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822089_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822090_SHBs_P-B      RNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLPCLIFLLVLLDY
FR822095_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822096_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDY
FR822105_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822106_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822107_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822109_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822132_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822158_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822160_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822161_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822163_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGHRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR822171_SHBs_P-B      QNSQSQVSSHSPTCCPPTCPGHRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325779_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325780_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLXFLLVLLDY
GQ325781_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
GQ325783_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325787_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ325788_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDY
GQ325789_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325790_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325791_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325793_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325795_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ325796_SHBs_P-B      QNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ358137_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ358139_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ358140_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ358143_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ358144_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377525_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377537_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377542_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377558_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377561_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377567_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377582_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ377587_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377606_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377610_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377612_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377622_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377629_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ475340_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486038_SHBs_P-B      QNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486050_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486057_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486084_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486089_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486106_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486123_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486141_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486155_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486159_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486161_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486190_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486196_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486219_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486222_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRXIIFLCILLLCLIFLLVLLDY
GQ486227_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486228_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRXIXFLXILLLCLIFLXVLLDY
GQ486233_SHBs_P-B      QNSQSXISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486234_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486242_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486245_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486277_SHBs_P-B      QNSQSQISSHXPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486291_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486300_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486334_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486353_SHBs_P-B      QNSQSQISXHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486359_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486364_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486366_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLGLLDY
GQ486371_SHBs_P-B      QNSQSQISSHXPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486373_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCHIFLLVLLDY
GQ486377_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486385_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486395_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486400_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486432_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486436_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486443_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRXMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486444_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486447_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486448_SHBs_P-B      QNSQSQISSHSPXCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486449_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486452_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDS
GQ486455_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486459_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486464_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486500_SHBs_P-B      QNSQSQISSHXPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486508_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486512_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486522_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLXVLLDY
GQ486523_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRXMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486540_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486558_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486569_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486573_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486588_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486620_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486628_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486629_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486630_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486636_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486640_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRXMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486657_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486666_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486679_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486689_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486739_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486749_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLXVLLDY
GQ486752_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486761_SHBs_P-B      QNSQSXISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486784_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLVDY
GQ486787_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486788_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486789_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
GQ486792_SHBs_P-B      QNSQSQISSHSPTCCPPICPGXRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486795_SHBs_P-B      QNSQSQISSHSPTCCPPICPGXRWMCLRRFIXFLCILLLCLIFLLVLLDX
GQ486796_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486797_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486799_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486801_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486802_SHBs_P-B      QNXQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486804_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486805_SHBs_P-B      QNSQSXISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486823_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486824_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486832_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ486833_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486841_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFLLVLLDY
GQ486847_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486850_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486852_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ486860_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486862_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486863_SHBs_P-B      QNSQSQXSSHSXTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDY
GQ486864_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486865_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486870_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
GQ486873_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
GQ924606_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
GQ924607_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924617_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
GQ924621_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924624_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924625_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924626_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924630_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924638_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924639_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924641_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GQ924644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924645_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
GQ924646_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ924647_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVVLDC
GQ924656_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GU078805_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078806_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078821_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078838_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078845_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078847_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU078849_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079201_SHBs_P-B      QNSQSPISNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
GU079210_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GU079251_SHBs_P-B      QNSQSPISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079268_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079272_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079278_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
GU079298_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079321_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079325_SHBs_P-B      QNSQSQISSHSLTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079327_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079328_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079329_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079340_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079350_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079358_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079361_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079370_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079372_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079382_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079385_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079397_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079403_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079415_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079428_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079444_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079448_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079449_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079463_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079489_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079491_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU357842_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU358470_SHBs_P-B      QNSQSQISSHSLTSCPPICPGYRWMCLRRFIIFLCTLLLCLIFLLVLLDY
GU358471_SHBs_P-B      QNSQSQISSHSLTSCPPICPGYRWMCLRRFIIFLCTLLLCLIFLLVLLDY
GU358472_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCTLLLCLIFLLVLLDY
GU358473_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU434372_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815549_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815550_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDY
GU815554_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815561_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815574_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815584_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815587_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815602_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815607_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815608_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815610_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815616_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815617_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815618_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815620_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815625_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815635_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815639_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815643_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815644_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
GU815651_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
GU815653_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
GU815656_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815657_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIILLCILLLCLIFLLVLLDY
GU815658_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815670_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLILLDY
GU815678_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815680_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU815699_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815701_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815709_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815710_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFTIFLCILLLCLIFLLVLLDY
GU815711_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815713_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815718_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815722_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815723_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815735_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815743_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815747_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815749_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815752_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815756_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815761_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815770_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815772_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815773_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815774_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815775_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815777_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815778_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815779_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815780_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU815783_SHBs_P-B      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652134_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652137_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652138_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652139_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
HE652140_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652141_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652143_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652144_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652145_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652147_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652148_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRLMCPRRFIIFLCILLLCLIFLLVLLDY
HE652150_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652151_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652153_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652154_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLYILLLCLIFLLVLLDY
HE652160_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
HE652161_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
HE652165_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
HE652166_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652168_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
HE652172_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
HE652174_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652176_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652177_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652181_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652183_SHBs_P-B      QNSRSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652187_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652188_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLTFLLVLLDY
HE652197_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLRLIFLLVLLDY
HE652198_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652199_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652201_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
HE652202_SHBs_P-B      QNSQSPISNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFWLVLLDY
HE652203_SHBs_P-B      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652207_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652210_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652214_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652216_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652219_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652225_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652227_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652228_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLQRFIIFLCILLLCLIFLLVLLDY
HE652230_SHBs_P-B      QNSQSRISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652232_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652235_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652241_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652243_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652248_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLRILLLCLIFLLVLLDY
HE652249_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRRMCLRRFIIFLCILLLGLIFLLVLLDY
HE652252_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652255_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652258_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652269_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652276_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652279_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652282_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
HE652285_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652287_SHBs_P-B      QSSQSQISSRSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HE652290_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652293_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HE652298_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HE652300_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652301_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652316_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
HE652319_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652321_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
HE652324_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652327_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652330_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYCWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652332_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652334_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIILLCILLLCLIFLLVLLDY
HE652336_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652362_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652365_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652376_SHBs_P-B      QNSQSQISSHSPTCCPPICPSYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652379_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652381_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652389_SHBs_P-B      QNSQSQISSRSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652391_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652403_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652408_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652409_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652410_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652419_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLSVLLDY
HE652421_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652423_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652426_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652429_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652434_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652435_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652442_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652447_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652450_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652456_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652459_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652463_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFSLVLLDY
HE652464_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652474_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652477_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652478_SHBs_P-B      QNSQSQISSHSPTRCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652485_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652495_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMRLRRFIIFLCILLLCLIFLLVLLDY
HE652503_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652509_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652510_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLILLDY
HE652514_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652515_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIILLCILLLCLIFLLVLLDY
HE652519_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652524_SHBs_P-B      QNSQSQISSHAPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652543_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652547_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652549_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652564_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652568_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFITFLCILLLCLIFLLVLLDY
HE652569_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652573_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVPLDY
HE652576_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652579_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLALLDY
HE652580_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652588_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652589_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652594_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652595_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652599_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652601_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDC
HE652602_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652603_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652604_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652605_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652606_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652607_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652608_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652610_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652611_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652612_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652615_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652618_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652620_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652621_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652622_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLPCLIFLLVLLDY
HE652623_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652625_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
HE652628_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652630_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652633_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRLIIFLCILLLCLIFLLVLLDY
HE652637_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652641_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652649_SHBs_P-B      QNSQSQISSHSPICCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652651_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HE652652_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652657_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652662_SHBs_P-B      QNSQSQISSHLLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652663_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652673_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFPCILLLCLTFLLVLLDY
HE652674_SHBs_P-B      QNSRSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652746_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652747_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652748_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652750_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652751_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652756_SHBs_P-B      QNSQSQISSHSPTCCPPTRPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652757_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652758_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652761_SHBs_P-B      LNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652762_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMRLRRFIIFLCILLLCLIFLLVLLDY
HE652765_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFHCILLLCLIFLLVLLDY
HE652766_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWVCLRRFIIFLCILLLCLIFLLVLLDY
HE652767_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652771_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652772_SHBs_P-B      QNSQSQISSHSPICCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVPLDY
HE652774_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652775_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652779_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652780_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652781_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652782_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652791_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652800_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652803_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652805_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652834_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652835_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652840_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652847_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652848_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652851_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652852_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652857_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652859_SHBs_P-B      QNSQSQISSHLPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011466_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011467_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
HM011469_SHBs_P-B      QNSQSQXSSHSPTCCPPTCPGYRWMXLRXFIIFLCILLLCLIFLLVLLDY
HM011470_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HM011471_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
HM011473_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011474_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011475_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011476_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
HM011477_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
HM011478_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
HM011480_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIXLLVLLDY
HM011482_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011483_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011484_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011487_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
HM011490_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011492_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011494_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011496_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011499_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDY
HM011503_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM011504_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
HM153811_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HM590576_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700546_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HQ700548_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HQ700549_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JF436921_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILPLCLIFLLVLLDY
JN604119_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604123_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JN604127_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604132_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604138_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604141_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604142_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604149_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
JN604187_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604212_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604213_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604219_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604221_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604224_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
JN604234_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604244_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604253_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604267_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN604311_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650140_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650144_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650153_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650155_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650157_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650159_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650166_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
JN650170_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650177_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN650184_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLXLLDX
JN650191_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
JN650196_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN792894_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYPWMCLRRFIIFLCILLLCLIFLLVLLDY
JN792896_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN792900_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN792901_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN792902_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN827419_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980198_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980207_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980216_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JN980218_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980220_SHBs_P-B      QNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980231_SHBs_P-B      QNSQSQISSHSPTCCPLICPGYRWMCLRRFIIFLYILLLCLIFLLVLLDY
JN980234_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980237_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980239_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980250_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980263_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980274_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980277_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980309_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980322_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLADY
JN980348_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980376_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN980379_SHBs_P-B      QNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
JN980382_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JN980383_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
JN980391_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDY
JN980393_SHBs_P-B      QNSQSQISSHSPTCCPPNCPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
JQ027311_SHBs_P-B      QNSQSQISSHXPTCCPPICPGYRWMCLRRXIXFLCILLLCLIFLLVLLDY
JQ027312_SHBs_P-B      QNSQSQTSSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ027315_SHBs_P-B      QNSQSPISRHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ027316_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ027325_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ027330_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ027334_SHBs_P-B      QNSQCQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ040128_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ040138_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ040147_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ040157_SHBs_P-B      QNSQSPTSNHSPTSCPPIXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040170_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341550_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341551_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341552_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341553_SHBs_P-B      QNSQSQISSHSPXCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341554_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341556_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341557_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341558_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341559_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341560_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDC
JQ341562_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDY
JQ341563_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341564_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341565_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ341566_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341567_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341568_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
JQ341569_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341571_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341572_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341573_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLLVLLDY
JQ341576_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ341577_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341580_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341582_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341585_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ341586_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341587_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341589_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ341590_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341591_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341592_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDY
JQ341594_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341595_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFXLVLLDY
JQ341596_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341597_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341598_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341600_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
JQ341601_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341604_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDY
JQ341605_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341606_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341607_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ341608_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ412090_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ412092_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ416164_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ416167_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ416176_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
JQ416305_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLWVLLDY
JQ429079_SHBs_P-B      QNSQSQISSHPPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ429081_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ429082_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ707734_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707735_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707739_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707740_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707747_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707749_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707755_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707764_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ707767_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDC
JQ801474_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JQ801494_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ801516_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX026879_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX026881_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX026883_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX026886_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX292746_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
JX292747_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX292750_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX292751_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLXCLIFLLVLLDY
JX292760_SHBs_P-B      QNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX429897_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX429901_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX429908_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX429910_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWTCLRRFIIFLCILLLCLIFLLVLLDY
JX429911_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX504531_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX504532_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX504533_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX504538_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISLLVLLDY
JX504543_SHBs_P-B      QNSQSQISSHSPTRCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX507200_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX507202_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX507208_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDY
JX507213_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX661479_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX661480_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
KC510646_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC510654_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC510655_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC510660_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774362_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774365_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774368_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774376_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC774377_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774380_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774388_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774397_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774400_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774412_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC774413_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774415_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774416_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774418_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792648_SHBs_P-B      QSSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792649_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792650_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792651_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDY
KC792652_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDX
KC792654_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792657_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792659_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLXLLDY
KC792660_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792661_SHBs_P-B      QNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792662_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLXILLLCLIFLLVLLDY
KC792663_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLXLLDY
KC792665_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KC792666_SHBs_P-B      QNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792668_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792670_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792671_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792674_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792675_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDY
KC792676_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLXVLLDY
KC792677_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792681_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792683_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRLMCLRRFIIXLCILLLCLIFLLVLLDY
KC792684_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792686_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792688_SHBs_P-B      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792689_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792692_SHBs_P-B      QNSQSQISSHSPTYCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
KC792693_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDY
KC792694_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792696_SHBs_P-B      QNSQSQICSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792697_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792698_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792699_SHBs_P-B      QNSQSQISXHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792701_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792702_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792703_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792705_SHBs_P-B      QNXQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792709_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFSLVLLDY
KC792711_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792712_SHBs_P-B      QSSQSQISNHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDC
KC792715_SHBs_P-B      QNSQSQISSHLLTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC792717_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792718_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792719_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792720_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792721_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
KC792722_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792723_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDY
KC792724_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792725_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792726_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792727_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KC792728_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792729_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792730_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
KC792732_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792733_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFLLVLLDY
KC792736_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792737_SHBs_P-B      QNSQSPISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792738_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792741_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRHFIIFLCILLLCLIFLLVLLDY
KC792742_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792743_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRXIIFLCILLLCLIFLLVLLDY
KC792744_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792745_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792748_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792749_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792750_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792752_SHBs_P-B      QNSQSQISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792754_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792755_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792756_SHBs_P-B      QNSQSQISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792758_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792760_SHBs_P-B      QNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792761_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDY
KC792763_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792764_SHBs_P-B      QNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KC792765_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792767_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLVLLDY
KC792768_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDY
KC792769_SHBs_P-B      XNSQSQISSHSPTCCPPICPGYRWMYLRRFIXFLCILLLCLIFLLVLLDY
KC792770_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792773_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792774_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIFLCILLLCLIFLLVLLDY
KC792777_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KC792778_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792779_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792780_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRSIIFLCILLLCLIFLLVLLDY
KC792781_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792782_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRXIIFLCILLLCLIFLLVLLDY
KC792783_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792785_SHBs_P-B      QNSQSQISSHSPTCCPLICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792786_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792787_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792788_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792789_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLLVLLDY
KC792791_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDY
KC792794_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792796_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792797_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792798_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792800_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
KC792801_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792802_SHBs_P-B      QNSQSQIXSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KC792804_SHBs_P-B      QNSQSQXSNHSPTCCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KC792805_SHBs_P-B      QNSQSQISNHXPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792807_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
KC792808_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIXFLCILLLCLIFLLVLLDY
KC792809_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
KC792810_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792811_SHBs_P-B      QNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792812_SHBs_P-B      QNSQSXISXHXPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792813_SHBs_P-B      QNSQSQISSHSPTCCPQTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792814_SHBs_P-B      QNSQSQISSHSPTCCPXICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792815_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792819_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792820_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792821_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792822_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792824_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KC792825_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMFLRRFIIFLCILLLCLIFLXVLLDY
KC792827_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792829_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792832_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792835_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792836_SHBs_P-B      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792837_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRXMCLRRFIIFLCILLLCLIFLLVLLDY
KC792839_SHBs_P-B      QNSQSQISSHSPTCCPQXCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792840_SHBs_P-B      QNSQSQXSSHSPTCCPPICPGYRWMCLRRFIIXLCILLLCLIFLLVLLDY
KC792841_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLLVLLDY
KC792842_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
KC792843_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792844_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792845_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMXLRRFIIXLCILLLCLIFLLVLLDY
KC792846_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792847_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDX
KC792848_SHBs_P-B      QNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792849_SHBs_P-B      QDLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792850_SHBs_P-B      QNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC792851_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792852_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792854_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792858_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792859_SHBs_P-B      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFLLVLLDY
KC792860_SHBs_P-B      QNLQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLGLLDY
KC792861_SHBs_P-B      QNSQSQISSHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC792863_SHBs_P-B      QNSQSQISNHSPTCCPPICPGYRWMCLRXFIIFLCILLLCLIFLLVLLDY
KC792864_SHBs_P-B      QNSQSQISSHSPTCCPXIC