HBVdb

Dataset for protein Pol of genotype B

[Download (right click)] [Sequences] [Repertoires]

2666 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


MK534603_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964109_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427105_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341582_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
MT426104_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011477_Pol_P-B      MPLSYXXFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386669_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173297_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011467_Pol_P-B      MPLSYQHFRKLLLL---EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276771_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377547_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073825_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276811_Pol_P-B      MPLSYQLFRKLLLLD--NEAGPLEEELPRLADEXLNRRVAEDLNL--G-D
HM011478_Pol_P-B      MPLSCQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
KC792896_Pol_P-B      --LSYQHFRKLLLLD--EXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993711_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-T
MF674419_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939661_Pol_P-B      MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVADELNL--G-N
EU306696_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
KX276798_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-X
KU964291_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KP406292_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276774_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLHL--G-N
KC792881_Pol_P-B      ----------LLLLD--KDTGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881947_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717820_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEDELPRLADEGLNRRVAEDLTL--G-N
KP148342_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148583_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX026886_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963946_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571326_Pol_P-B      MPLSYQRFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792811_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
JQ341596_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MK534694_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173384_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793038_Pol_P-B      -----------LLLDPDAELGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429897_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793066_Pol_P-B      ----------LLLLD--KEAGPLEEELPRLADDXLNRRVAEDLNL--G-N
AF461360_Pol_P-B      MPLSYQRFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964118_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793042_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB212626_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406318_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793125_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674391_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358140_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717792_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRFAEDLNL--G-N
KC792719_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793128_Pol_P-B      ----------LLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-T
MW999613_Pol_P-B      MPLSYQHFRKLLLLE--DXAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KJ803787_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRFAEDLNL--G-N
GQ358146_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276783_Pol_P-B      MPLSYQHFRKLLLLE--AGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406284_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JF436921_Pol_P-B      MPLSYQCFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881869_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427033_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717807_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM213036_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534659_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP659255_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNLRVAEDLNL--G-N
KX276796_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470962_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--E-N
KC793064_Pol_P-B      --LSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815780_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ429081_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM875417_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX870001_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEEPPRLADEGLNRRVAEDLNL--G-N
KJ790200_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964302_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KP148419_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ040157_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276858_Pol_P-B      MPLSYQHFRKLLLLD--BXAGPLEEELPRLADEGLNRRVAEDLNL--G-B
EU881998_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386656_Pol_P-B      MPLSYQHFRNILLLD--KDAGPLEEELPRLADQGLNRRVAEDLGL--G-N
EU522074_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924606_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173389_Pol_P-B      MHLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU305547_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793106_Pol_P-B      -----------LLLD--EEAGPLEEELPRLADEGLNRRVAEDLNLGIG-N
AY217361_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899787_Pol_P-B      MPLSYQHFRKLLSLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792761_Pol_P-B      ----------LLLSD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073823_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ377158_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
KX276827_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121251_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427040_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK818223_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG826152_Pol_P-B      MPLSYQHFRRLVLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534575_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801507_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358145_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLAEEGLNRRVAEDLNL--G-N
EU939639_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073838_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
EF494381_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC603638_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
KY881794_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341554_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLXL--G-N
JX504533_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803797_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRFADDLNL--G-N
MT427096_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306704_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774370_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLIL--G-N
HM011473_Pol_P-B      MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792649_Pol_P-B      ----------LLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY217359_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MW845307_Pol_P-B      MPLSYQRFRKLLLLD--KDAGPLEEELPRLADAGLNRRVAEDLNL--G-N
AB073839_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY800389_Pol_P-B      MPLSYQPFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964287_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MW845291_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB302095_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
GQ924611_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148318_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ439548_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
JX661472_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173424_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276786_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ787477_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792949_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEXLNRRVAXELNL--G-N
ON402781_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADQGLNHRVAEDLNL--G-N
MZ671238_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB246341_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
KU964278_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964267_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900111_Pol_P-B      MPLSYQHFRKLLLLE--DEAGPLEEELPRLADEGLNHRVAEDLNL--GID
MT645005_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964283_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792667_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881801_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276797_Pol_P-B      MPLSYQHFRXLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLXL--G-X
EF494380_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534611_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ995804_Pol_P-B      MPLSYQHFRKLLLLD--QESGPLEEELPRLADEGLNRRVADDLNL--G-N
AB931169_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KC792976_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLSL--G-X
KC792920_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK052962_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167093_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774369_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993708_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774368_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ361535_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792770_Pol_P-B      ----------LLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900107_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AY596112_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ995802_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
MZ439538_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
KJ173383_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964299_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KJ717837_Pol_P-B      MPLSYQRFRKLLLLD--TDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276792_Pol_P-B      MPLSYQHFRXLLLLE--ZDAGPLEEELPRLADEGLNRRVAEDLGL--G-N
AB642093_Pol_P-B      MPLSYQHFRKLLLLD--DESGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173411_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792955_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLHL--G-N
KJ717813_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774379_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675785_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406188_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571351_Pol_P-B      MPLSYQHFRKLVLLD--KEAGPLKEELPRLADEGLNRRVAEDLNL--G-N
MW845297_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KU964292_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
AB246342_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
EU306679_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053174_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AY217368_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964296_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
EU939677_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLHL--G-D
GQ377644_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELHHLADEGLNRRVAEDLNL--G-N
KX276779_Pol_P-B      MPLSYQHFRKLLLLD--ZXAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MK534683_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
JN792900_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
FJ386636_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173418_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845286_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386660_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964269_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406333_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
D50521_Pol_P-B        MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLGL--G-N
DQ463790_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KC792897_Pol_P-B      MPLSYQRFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC279269_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MG571358_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AY217357_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964300_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MF674426_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276809_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173298_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341565_Pol_P-B      MPLSYQHFRKLLLLD--XXAGPLEEELPRLADEGLNRRVAEDLNL--G-B
AY596111_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073849_Pol_P-B      MPLSYQHFRKLXLLD--DEAGPLEEELPRLADEGLNXRVAEDLNL--G-N
KX276825_Pol_P-B      MPLSYQCFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
KP148341_Pol_P-B      MPLSYQHFRKLPLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427044_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377566_Pol_P-B      MPLSYQHFRKLQLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757436_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774404_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY206390_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148359_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276778_Pol_P-B      MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964265_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276772_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793199_Pol_P-B      --LSYQRFRXLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792859_Pol_P-B      --LSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011484_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562224_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924635_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDFNV--G-N
KU964381_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939559_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB010289_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB010290_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB010291_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB010292_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB014366_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB031267_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB033554_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB033555_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRPVAEDLNL--G-N
AB073821_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073822_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073824_Pol_P-B      MPLSYQHFRKLLLLD--HEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073826_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073827_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073828_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073829_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073830_Pol_P-B      MPLSYQXFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073831_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073832_Pol_P-B      MPLSYQHFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073833_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073834_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073835_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073836_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073837_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073840_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073841_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073842_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
AB073843_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073844_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073845_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073846_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHHVAEDLNL--G-N
AB073847_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073848_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073850_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073851_Pol_P-B      MPLSYQHFRRLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073852_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073853_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073854_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073855_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB073857_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB073858_Pol_P-B      MPLSYQHFRKLVLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
AB100695_Pol_P-B      MPLSYPPFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB106884_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB115551_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB117759_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
AB195933_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB195934_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB205119_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB205120_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB205121_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB205122_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB212625_Pol_P-B      MPLSYQHFRKLLLLD--EQAGPLEEELPHLADEGLNRRVAEDLNL--G-N
AB219426_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB219427_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB219428_Pol_C-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB219429_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB219430_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB231909_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGFNHRVAEDLNL--G-N
AB241117_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB246339_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AB246340_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB246343_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB287314_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287315_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287316_Pol_P-B      MPLSYQHFRKLLLLD--DESGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287317_Pol_P-B      MPLSYQYFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287318_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287319_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287320_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-D
AB287321_Pol_P-B      MPLSYQHFRKLLLLD--DEAGALEEELPRLADPDLNHRVAEDLNL--G-D
AB287322_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287323_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADQDLNRRVAEDLNL--G-N
AB287325_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
AB287326_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB287327_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADAGLNHRVAEDLNL--G-N
AB287329_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB300364_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB300371_Pol_P-B      MPLSYQLFRKLLLLD--NEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB302942_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB302943_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB362933_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB365445_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB368295_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
AB471854_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB471855_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB493827_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB493833_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB493835_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB555498_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB555499_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB642094_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB642101_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB675676_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB713527_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB713528_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB713531_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB713532_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB828708_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNXRVAEDLNL--G-T
AB900095_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB900096_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900097_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADAGLNRRVAEDLNL--G-N
AB900098_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
AB900102_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900103_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB900104_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
AB900105_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900106_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB900108_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB900110_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB900112_Pol_P-B      MPLSYQHFRKLLLLD--DGAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AB931168_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
AF100308_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF100309_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121243_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AF121244_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AF121247_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121248_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121249_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121250_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF282917_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF282918_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF479684_Pol_P-B      MPLSYQHFRKLLLLD--GEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
AJ627225_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011084_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011085_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011086_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011087_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011088_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011089_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011090_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011091_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011092_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011093_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011094_Pol_P-B      MPLSYQHFRRLVLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011095_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AP011096_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY033072_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AY033073_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
AY163869_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167089_Pol_P-B      MPLSCQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167094_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167097_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167098_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167100_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY167101_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLHL--G-D
AY167102_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY206373_Pol_P-B      ---------KLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY206375_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY206383_Pol_P-B      MPLSYQRFRRLLLLE--QDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY206391_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY217355_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY217356_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY217360_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRIAEDLNL--G-N
AY217362_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY220697_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY220698_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY220703_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY220704_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY293309_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY518556_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596102_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596103_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
AY596104_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596105_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596106_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596109_Pol_P-B      MPLSCQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY596110_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY766463_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY800391_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
D00329_Pol_P-B        MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
D00330_Pol_P-B        MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
D00331_Pol_C-B        MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
D23678_Pol_P-B        MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
D23679_Pol_P-B        MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
D50522_Pol_P-B        MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLGL--G-N
DQ448619_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448620_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448621_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448622_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
DQ448623_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448624_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448625_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448626_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448627_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ448628_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-K
DQ463787_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463788_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
DQ463789_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNRRVAEDLNL--G-N
DQ463791_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
DQ463792_Pol_P-B      MPLSYQHFRKLLLLD--TDAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463793_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463794_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-D
DQ463795_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463796_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
DQ463797_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNRRVAEDLNL--G-N
DQ463798_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463799_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
DQ463800_Pol_P-B      MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ463801_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNLRVAEDLNL--G-N
DQ463802_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
DQ904357_Pol_P-B      MPLSYQHFRRLVLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ975271_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993680_Pol_P-B      MPLSYEDFRRLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993681_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993683_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993684_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993685_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993686_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
DQ993697_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993698_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993699_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993700_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993701_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993702_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993703_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993704_Pol_P-B      MPLYYQHFRKLLLLD--EQAGPLEKELPRLADEGLNRRVAEDLNL--G-N
DQ993705_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993706_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993707_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
DQ993709_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ993710_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ995801_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
DQ995803_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EF134945_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EF134946_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EF473971_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
EF473972_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
EF473973_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRPVADDLNL--G-N
EF473974_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EF473975_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVADDLNL--G-N
EF473976_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EF473977_Pol_P-B      MPLSYQHFRRLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU139543_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU158262_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU158263_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU305548_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306677_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306678_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306681_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306695_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
EU306699_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306700_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306701_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306702_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306703_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306705_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306707_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRAAEDLNL--G-N
EU306708_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306709_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306710_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306711_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306712_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU330989_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU330995_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU330996_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU330997_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU439018_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU439020_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU439021_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU439022_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU439023_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU487256_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU487257_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU522067_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU522072_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU547563_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU564822_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU564823_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU564824_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU564826_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU570069_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU570070_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU570071_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU570075_Pol_P-B      MPLSYQHFRNILLLD--KDAGPLEEELPRLADQGLNRRVAEDLGL--G-N
EU579441_Pol_P-B      MPLSYQHFRKILLLD--QDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU589335_Pol_P-B      MPLSYQHFRNILLLD--KDAGPLEEELPRLADQGLNRRVAEDLGL--G-N
EU595031_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU796066_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
EU796067_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU796068_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU881997_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU882002_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU882004_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU919171_Pol_P-B      MPLSYQRFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU919172_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU919173_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU919175_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU919176_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939633_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939634_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939636_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939638_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939663_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939664_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939665_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939666_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939667_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
EU939669_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939670_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-D
EU939671_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939672_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939673_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939674_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
EU939675_Pol_P-B      MPLSYQHFRSVLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939676_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939678_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU939679_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRLVAEDLNL--G-N
FJ023631_Pol_P-B      MPLSYQHFRKLLLLD--QESGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ023632_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ023633_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
FJ023634_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ023635_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
FJ023636_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ023637_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEGLPRLADEGLNRRVAEDLNL--G-N
FJ023638_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
FJ032342_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ032344_Pol_P-B      MPLSYQHFRNILLLD--KDAGPLEEELPRLADQGLNRRVAEDLGL--G-N
FJ032352_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ032353_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ032354_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ032357_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ032358_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ349236_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
FJ386582_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386583_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386584_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386600_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386608_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386610_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386615_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386634_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386642_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386648_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-I
FJ386654_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386655_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386658_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386666_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386668_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386675_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386676_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
FJ386680_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386681_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
FJ386682_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386683_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
FJ386684_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ386688_Pol_P-B      MPLSYQRFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ518812_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562219_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562222_Pol_P-B      MPLSYQHFRKLLLLD--EKAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562231_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562234_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562236_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562237_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562240_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562246_Pol_P-B      MPLSYQHFRRLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562253_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562254_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
FJ562257_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562259_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562260_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562289_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562296_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562303_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562311_Pol_P-B      MPLSYQHFRKLLLLE--GDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562312_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562316_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
FJ562321_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ562322_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ787444_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ787475_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ787476_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899779_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899784_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899785_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899790_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
GQ358136_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358137_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLAEEGINRRVAEDLNL--G-N
GQ358138_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358139_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDFNL--G-N
GQ358141_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358142_Pol_P-B      MPLSYRHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358143_Pol_P-B      MPLSYQHFRKLVLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358144_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358147_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRLVAEDLNL--G-N
GQ358148_Pol_P-B      MPLFYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358149_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358150_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358151_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ358152_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377519_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377525_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377537_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377542_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377550_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377558_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377561_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377567_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377568_Pol_P-B      MPLSYQHFRKLQLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377569_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377582_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377587_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377588_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377606_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377610_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377612_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377622_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
GQ377625_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAKDLNL--G-N
GQ377629_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377638_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377639_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ377641_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
GQ377643_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ475340_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924603_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924605_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPXLAXEGLNRRVAEDLNL--G-N
GQ924607_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNGRVAEDLNL--G-N
GQ924608_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924610_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924617_Pol_P-B      MPLSYQHFRKLLLLD--HEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924621_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924624_Pol_P-B      MPLSYPLFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924625_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924626_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
GQ924627_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924628_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
GQ924630_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
GQ924631_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924632_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924634_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924637_Pol_P-B      MPLSYQRFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924638_Pol_P-B      MPLSYQRFRKLLLLE--DEAGPLEEELPRVADEGLNRRVAEDLNL--G-N
GQ924639_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRVADEGLNRRVAEDLNL--G-N
GQ924640_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924641_Pol_P-B      MPLSYQHFRSVLLLV--EGAGPLEEELPRLADEGLNRRVAEDLNV--G-N
GQ924644_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924645_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924646_Pol_P-B      MPLSYQHFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924647_Pol_P-B      MPLSYQRFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924648_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924651_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924653_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924654_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GQ924656_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU357842_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU434372_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU434373_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU451682_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815548_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815549_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815550_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNP--G-N
GU815551_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815552_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815554_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815555_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815557_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815558_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815560_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815561_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815565_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815570_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815571_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815572_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815573_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815574_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815578_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815579_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815581_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815586_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815587_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815588_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815594_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815596_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815598_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815599_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815601_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815602_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815604_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815607_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815608_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815610_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815616_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815617_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815618_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815619_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815623_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815624_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815625_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815627_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815634_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815635_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815638_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815639_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815640_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815641_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815642_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815648_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815650_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815651_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815654_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815656_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815657_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815658_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815661_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815662_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLDRRVAEDLNL--G-N
GU815663_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815667_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815670_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815672_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815673_Pol_P-B      MPLSYQHFRKLLLLG--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815677_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815678_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815679_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815683_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815684_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815695_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815699_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815701_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815703_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815704_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815706_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815707_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815711_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815712_Pol_P-B      IPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815713_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815715_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815716_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815718_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815720_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815721_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815722_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815723_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815724_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815725_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815726_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815727_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815728_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815729_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815730_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815731_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815733_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815735_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815739_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815743_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815745_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815747_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815749_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815750_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815752_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815753_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815755_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815759_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815760_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815761_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815765_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEEPPRLADEGLNRRVAEDLNL--G-N
GU815769_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815770_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815772_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815773_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815774_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815777_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815778_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815779_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815782_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815783_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011466_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011469_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-B
HM011470_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011471_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
HM011474_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAXDLXL--G-N
HM011475_Pol_P-B      MPLSYQHFRKXLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011476_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011480_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011482_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011483_Pol_P-B      MPLSYQHFRKLLLLD--EXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011487_Pol_P-B      MPLSYQRFRKLLLLD--DAAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011490_Pol_P-B      MPLSYQHFRRLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011492_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011494_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM011496_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
HM011499_Pol_P-B      MPLSYQHFRKLLLLD--BEAGPLEEELPRLADEGLNRRVAEDLNL--G-B
HM011503_Pol_P-B      MPLSYQHFRKLLXLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-X
HM011504_Pol_P-B      MPLSYQRFRKLVLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HM153811_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HQ700546_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
HQ700548_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
HQ700549_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JF412801_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JF899335_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JN406371_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JN792894_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
JN792896_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNRRVAEDLNL--G-N
JN792897_Pol_P-B      MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNL--G-N
JN792901_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNLRVAEDLTL--G-N
JN792902_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNLRVAEDLTL--G-N
JN827419_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027311_Pol_P-B      MPLSYQHFRKLLLLD--DEXGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027312_Pol_P-B      MPLSYQHFRKLLLLD--XXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027313_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADDDLNRRVAEDLNL--G-N
JQ027315_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
JQ027316_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027325_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027330_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
JQ027334_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ040125_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRIAEDLNL--G-N
JQ040128_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-B
JQ040138_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ040147_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ040170_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ040171_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLXDEGLNRRVAEDLNL--G-N
JQ040173_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341549_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341550_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341551_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341552_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341553_Pol_P-B      MPLSYQHFRKLLLLD--EXAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ341555_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341556_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-T
JQ341557_Pol_P-B      MPLSYQHFRKLLLLD--EXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341558_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341559_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341560_Pol_P-B      MPLSYQHFRRLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341561_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-T
JQ341562_Pol_P-B      MPLSYQYFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341563_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341564_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341566_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341567_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLHL--G-D
JQ341568_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341569_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341570_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341571_Pol_P-B      MPLSYXHFRKLLLLE--DGAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ341572_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLSL--G-N
JQ341573_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341574_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341575_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341576_Pol_P-B      MPLSYPHFRRILLLD--QDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341577_Pol_P-B      MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341578_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341579_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341580_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPHLADEGLNRRVAEDLNL--G-N
JQ341581_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ341583_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLXDEGLNRRVAEDLNL--G-N
JQ341584_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341585_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341586_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341587_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
JQ341588_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEELNL--G-N
JQ341589_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNHRVAEDLNL--G-D
JQ341590_Pol_P-B      MPLSYQHFRKLLLLD--DXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341591_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341593_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341594_Pol_P-B      MPLSYQHFRKLLLLX--XEAGPLEEELPRLADEGLNRRVAEDLXL--G-N
JQ341595_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341597_Pol_P-B      MPLSYQHFRKLLLLD--DXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341598_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341600_Pol_P-B      MPLSYQCFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341601_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ341603_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
JQ341604_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341605_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ341606_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-X
JQ341607_Pol_P-B      MPLSYQRFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
JQ341608_Pol_P-B      MPLSYQHFRKLLLLD--EKAGPLEEELPRLADEGLNRRVAEDLSL--G-N
JQ341609_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
JQ429082_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ707734_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707735_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707738_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707739_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707740_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707742_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707744_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707747_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707750_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707753_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707762_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707763_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707765_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ801471_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801474_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801479_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801494_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801506_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
JQ801512_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801514_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801516_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ801524_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX026879_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX026881_Pol_P-B      MPLSYQHFRRLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX026883_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429899_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429900_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429901_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429902_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429908_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX429910_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-I
JX429911_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNCRVAEDLNL--G-N
JX504532_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX504538_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX504543_Pol_P-B      MPLSYRHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX507210_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX507213_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX507215_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661470_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661471_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661473_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661474_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661475_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661476_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661478_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661479_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661480_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661481_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661482_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661483_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX661484_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JX869998_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JX869999_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEEPPRLADEGLNRRVAEDLNL--G-N
JX978431_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC492739_Pol_P-B      MPLSYQHFRRLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510641_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510642_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510643_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510644_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510646_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510648_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510649_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510650_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510651_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510652_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510653_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510654_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510655_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510656_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510657_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510658_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510659_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510660_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774362_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774363_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774365_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774366_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774367_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774371_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774372_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774373_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774374_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774375_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774376_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774377_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774378_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774380_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774381_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774382_Pol_P-B      MHLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774383_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774384_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774385_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774386_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774387_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774388_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774389_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774390_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774391_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774392_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774393_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774394_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774395_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774396_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774397_Pol_P-B      MPLSYQHFRKILLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774398_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774399_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774400_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774401_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774402_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774403_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774405_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774406_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774407_Pol_P-B      MPLSYQHFRKLLLLD--EEAGLLEEELPRLADDGLNRRVAEDLNL--G-N
KC774408_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774409_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774410_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774411_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774412_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774413_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774415_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLSL--G-N
KC774416_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774417_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774418_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC774419_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792652_Pol_P-B      MPLSYQHFRKLLLLD--QDARPLEEELPRLADEGLNRRVADDLNL--G-N
KC792663_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792674_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792681_Pol_P-B      ----------LLLLD--EDAGPLEEELPRLADEGLNRRVAEGLNL--G-N
KC792701_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792712_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
KC792717_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792742_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792745_Pol_P-B      MPLSYQHFRKLLLLD--HDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792748_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792756_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792765_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792767_Pol_P-B      --LSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KC792777_Pol_P-B      MPLSCQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLGL--G-T
KC792780_Pol_P-B      MPLSYQHFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLGL--G-N
KC792786_Pol_P-B      MPLSYQHFRKLLLLD--EESGPLEEELPRLADEGLNRRVAEDLNL--G-X
KC792798_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792800_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792815_Pol_P-B      ---------KLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792843_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792844_Pol_P-B      ----------LLLLD--PEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KC792847_Pol_P-B      ----------LLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792860_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KC792885_Pol_P-B      MPLSYQYFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792889_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792892_Pol_P-B      ----------LLLLD--NEAGPLEEELPRLADEDLNRRVAEDLNL--G-D
KC792901_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792904_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KC792935_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
KC792936_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLXL--G-B
KC792938_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792939_Pol_P-B      --LSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792945_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792946_Pol_P-B      ---------KLLLLD--EDXGPLEEELPRLADEGLNRRVAEDLNL--G-X
KC792947_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEDLNRRVAEDLNL--G-N
KC792948_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792959_Pol_P-B      ----------LLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792970_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792973_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KC792974_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792982_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC792985_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLHL--G-D
KC792994_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793004_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KC793006_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793030_Pol_P-B      MPLSYQQFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793045_Pol_P-B      ----------LLLLD--EESGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793061_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793069_Pol_P-B      --LSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KC793076_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEXLNXRVABDLXL--G-N
KC793099_Pol_P-B      ----------LLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793101_Pol_P-B      ----------LLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793115_Pol_P-B      ----------LLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793132_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793139_Pol_P-B      --LSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793168_Pol_P-B      --LSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793180_Pol_P-B      MPLSYQRFRKLLLLD--ZEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC793189_Pol_P-B      -PLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNHRVAEDLHL--G-N
KF053159_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADKGLNRRVAEDLNL--G-N
KF053162_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053163_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053165_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053171_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADKGLNRRVAEDLNL--G-N
KF053180_Pol_P-B      MPLSYPHFRRLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLGL--G-N
KF053182_Pol_P-B      MPLSYPHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLGL--G-N
KF053189_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
KF053190_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053191_Pol_P-B      MPLSYQHFRKILLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053192_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KF053194_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ173339_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173341_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173342_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173343_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173347_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173348_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173351_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173352_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173353_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173355_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173356_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173357_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173359_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173360_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173361_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173362_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173363_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173366_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173367_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173368_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173369_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173371_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173372_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173374_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173375_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEDLNRRVAEDLNL--G-N
KJ173376_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173377_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173378_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--R-N
KJ173379_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173381_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173382_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173385_Pol_P-B      MRLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173386_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173387_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173397_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
KJ173399_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
KJ173401_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173403_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173405_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173407_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173409_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173414_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173416_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173420_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173422_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173425_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ410490_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ410500_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KJ410502_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ410507_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ410516_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ410517_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717795_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717796_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717797_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717805_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ717806_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ717808_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRFADDLNL--G-N
KJ717817_Pol_P-B      MPLSYQHFRKLVLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KJ717818_Pol_P-B      MPLSYQRFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAENLHL--G-D
KJ717829_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRFAEDLNL--G-T
KJ717831_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717835_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717836_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717840_Pol_P-B      MPLSYQHFRKLLLFD--NAAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ717842_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRFAEDLNL--G-N
KJ717843_Pol_P-B      MPLSYQRFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803752_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADKGLNRRVAEDLNL--G-N
KJ803755_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ843165_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM213032_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM213034_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KM213035_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM359440_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM392072_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM392083_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM392084_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAXDLNL--G-N
KM875416_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM875418_Pol_P-B      MPLSYQHFRKLLLLEEGEGAGLLEEELPRLADEGLNRRVAEDLNL--G-N
KM875420_Pol_P-B      MPLSYQHFRRLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KM875421_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP036970_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148314_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KP148317_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148319_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148321_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148322_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148323_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KP148324_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148325_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148326_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148327_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148329_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148330_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148331_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148332_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148333_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148334_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KP148335_Pol_P-B      MPLSYQHFWKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148336_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148340_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148343_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148345_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148348_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148349_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148356_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148357_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148360_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148361_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148362_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148363_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148365_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148366_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148367_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148368_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148369_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148370_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148371_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148372_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148373_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148374_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148375_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148377_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148378_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148379_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148380_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148382_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148383_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148384_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148385_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148387_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148389_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148390_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148391_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148392_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148394_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148395_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148397_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148399_Pol_P-B      MPLSYQHFRKLLLLD--DGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148400_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148401_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148402_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148403_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148405_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148406_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148407_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148409_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148410_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148411_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148414_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148415_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148416_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148418_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148420_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148423_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148424_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148425_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148426_Pol_P-B      MPLSNQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148429_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148430_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148432_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148435_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148437_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148438_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDHNL--G-N
KP148439_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148440_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148452_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148453_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGFNRRVAEDLNL--G-N
KP148455_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148456_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148457_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148458_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148459_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAENLNL--G-N
KP148461_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148579_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148580_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148581_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148582_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406162_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406163_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406165_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406166_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406167_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406171_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406172_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KP406173_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406176_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406177_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406179_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406181_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406182_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406186_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406187_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406190_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406194_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406197_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406201_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406203_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406206_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406220_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406229_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406232_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406233_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406234_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406236_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406237_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406238_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406239_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406241_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406244_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406245_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406246_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406249_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406251_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406252_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406253_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406255_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406257_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406258_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406260_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406262_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406263_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KP406264_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406265_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406266_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406269_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406270_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406271_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406272_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406273_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406274_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406275_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406276_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406277_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406278_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406279_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406280_Pol_P-B      MPLSYQHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406281_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406282_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406283_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406285_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406286_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406287_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406288_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406289_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406290_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406291_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406293_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406296_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406297_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406298_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406299_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406300_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406301_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406302_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406303_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406304_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406305_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406306_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406307_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406311_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406319_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406320_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406322_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406325_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406327_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406330_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406331_Pol_P-B      MPLSYQHFRKLLLLD--EDAAPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406332_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP659219_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659220_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659223_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659224_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659234_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLKEELPRLANENLNHRVAKNLNL--G-N
KP659235_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLXEELPRLADEDLNHRVAXBLNL--G-N
KP659237_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659239_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADQDLNHRVAEDLNL--G-N
KP659240_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADXXLNHRVAEDLNL--G-N
KP659244_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLXDEDLNHRVAEDLNL--G-N
KP659245_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADQDLNHRVAEELDL--G-I
KP659246_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659247_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659248_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659249_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659250_Pol_P-B      MPLSYQCFRKLLLLD--DVTGPLEEELPRLADEDLNRRVAEDLNL--G-N
KP659251_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659252_Pol_P-B      MPLSYQYFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659253_Pol_P-B      MPLSYQCFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KP659254_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
KR152339_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KR232337_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KT749820_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU234318_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963799_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963814_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963815_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963816_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963828_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963829_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963834_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963835_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963841_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963842_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963843_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963853_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963854_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963945_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963948_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963949_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963951_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963953_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963957_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963958_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963960_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963962_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963964_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963965_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963967_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963968_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963970_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963971_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963974_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963976_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963980_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963981_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963987_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964079_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964080_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964083_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964084_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964088_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964090_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964093_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964094_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964095_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964096_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964097_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964098_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964101_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964102_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964103_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964104_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964105_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964106_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964108_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964110_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964111_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964112_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964114_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964115_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964116_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964119_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964121_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964122_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964123_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964124_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964126_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964130_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964131_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964135_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964136_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964137_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964138_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964139_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964140_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964141_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964143_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964146_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964149_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964150_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964152_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964153_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964154_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964155_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964156_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964157_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964158_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964159_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964162_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964164_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964165_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLKL--G-N
KU964166_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964167_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964168_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964244_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964245_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964246_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964247_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964248_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964249_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964250_Pol_P-B      -------FRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964251_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964253_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964254_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964255_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964257_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964258_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964259_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964260_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964261_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964262_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964272_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964273_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964274_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964277_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964281_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964282_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964394_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276770_Pol_P-B      MPLSYQRFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KX276773_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276777_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276781_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276782_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276784_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276785_Pol_P-B      MPLSXQHFRKLLLLD--EXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276787_Pol_P-B      MPLSYQRFRKLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276788_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276790_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KX276791_Pol_P-B      MPLSYQXFXXLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KX276793_Pol_P-B      MPLSYQHFRKLLLLX--QGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276794_Pol_P-B      MPLSYQHFRKLLLLD--EEXGPLEEELPRLADDDLNRRVAEDLNL--G-N
KX276795_Pol_P-B      MPLSYXXFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276799_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276800_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-T
KX276801_Pol_P-B      MPLSYQHFRKLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276802_Pol_P-B      MPLSYQRFLKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276803_Pol_P-B      MPLSYQRFRKLLLLD--KEAGPLEEELPRLADEGLNRRVADDLNL--G-N
KX276804_Pol_P-B      MPLSYQRFRKLLLLX--XXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276805_Pol_P-B      MPLSYQRFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276806_Pol_P-B      MPLSYQLFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276807_Pol_P-B      MPLSYXXFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276808_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276810_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276812_Pol_P-B      MPLSYQHFRKLLLLD--NESGPLEEELPRLADEGLNRRVAEDLHL--G-N
KX276813_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276814_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276815_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276817_Pol_P-B      MPLSYQHFRKLLLLE--DEAGPLEEELPRLADEGLNRRVAEDLDL--G-X
KX276818_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KX276819_Pol_P-B      MPLSYXHFRRLVLLD--DXAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KX276820_Pol_P-B      MPLSYQHFRKLLLLD--HXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276821_Pol_P-B      MPLSYQHFRKLLLLE--DEAGSLEEELPRLADEGLNRRVAEDLNL--G-N
KX276822_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-B
KX276823_Pol_P-B      MPLSXQHFRKLLLLD--BDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276824_Pol_P-B      MPLSYQHFRKLXLLD--BEAGXLEEELPRLADEGLNRRVAEDLNL--G-X
KX276828_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276829_Pol_P-B      MXLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX276830_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX765841_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX765854_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KX765856_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY417926_Pol_P-B      MPLSYQRFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470830_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470832_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470833_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470834_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470835_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470836_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470838_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470841_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470953_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470954_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470956_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470960_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470961_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY629635_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY629636_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881721_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881781_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881782_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881783_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881784_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881785_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881786_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881787_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881788_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881789_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881790_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881791_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881793_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881795_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881796_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881797_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881798_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881800_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881808_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881820_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881822_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881823_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881824_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881826_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881827_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881828_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881829_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881831_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881833_Pol_P-B      MPLSYQRFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881834_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881836_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881838_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881839_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881841_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881842_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881843_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881844_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881846_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881847_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881848_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881849_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881850_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881851_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881852_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881853_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881854_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881855_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881856_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881857_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881858_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881859_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881860_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881861_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVSEDLNL--G-N
KY881862_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLSRRVAEDLNL--G-N
KY881863_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881864_Pol_P-B      MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881865_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881866_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881867_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881868_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881893_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881894_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881895_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881896_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881898_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881899_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881900_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881904_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881905_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881906_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881907_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881908_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881909_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881910_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881911_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881912_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881914_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881944_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881945_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881946_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881948_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881949_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881950_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881951_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881952_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KY881953_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KY881954_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KY881955_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881956_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KY881957_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRIAEDLNL--G-N
KY881958_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC279268_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
LC279272_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
LC279273_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
LC349868_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349869_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349870_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349871_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349872_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349873_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349874_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349875_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349877_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349878_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC349879_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC461174_Pol_P-B      MPLSYQHFRKLLLLD--DEXGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC461175_Pol_P-B      MPLSYQHFRKLLLLD--DEXGPLEEELPRLADEXLNRRVAEDLNL--G-N
LC677084_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
M54923_Pol_P-B        MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRPVAEDLNL--G-N
MF621878_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674382_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674383_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674384_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674385_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674387_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674389_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674392_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674393_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674394_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674395_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674396_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674397_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNHRVAEDLNL--G-N
MF674400_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674401_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674404_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674405_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674406_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674407_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEDLNHRVAEDLNL--G-N
MF674409_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674410_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674413_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674414_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674415_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674416_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674420_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-D
MF674421_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674422_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MF674423_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674424_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674427_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674431_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674432_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674433_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674434_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674436_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674437_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEELNL--G-N
MF674438_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674439_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLSL--G-T
MF674440_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674441_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674443_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674445_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674446_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674447_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674448_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674449_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674450_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
MF674451_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674452_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674453_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674455_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADESLNRRVAEDLNL--G-N
MF674456_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674459_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674460_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674461_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674462_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674464_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674465_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674466_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674469_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674470_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674473_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674476_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674477_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674478_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MF674479_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674480_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674481_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674482_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674485_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674487_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674488_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674490_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674491_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674492_Pol_P-B      MPLSYQRFRKLLLLD--HEAGPLEEELPRLADEGLNHRVAEELNL--G-N
MF674493_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEELNL--G-N
MF674495_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674496_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNHRVAEDLNL--G-N
MF674497_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674498_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674499_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674500_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674503_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRHVAEDLNL--G-N
MF674505_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674506_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674507_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674508_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674509_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674510_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674511_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MF674512_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674513_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MF674515_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG372436_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571321_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571323_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571325_Pol_P-B      MPLSYQRFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MG571327_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571328_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571329_Pol_P-B      MPLSYQRFRKLLLLD--KDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571331_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571333_Pol_P-B      MPLSYQRFRKLLLLD--HEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571334_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MG571336_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEKELPRLANEGLNRRVAQHLNL--G-N
MG571337_Pol_P-B      VPLWYKHFRKLPLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571338_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571339_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571340_Pol_P-B      MPLSYQLFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571341_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571342_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571344_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571346_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571347_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571348_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571349_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLQEELPRLADEGLNRRVAKDLNL--G-N
MG571350_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571352_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571353_Pol_P-B      MPLSYQHFRKLLLLE--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
MG571354_Pol_P-B      MPLSYQHFRKLLLLD--NDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571355_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571356_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571357_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571360_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571361_Pol_P-B      MPLSYQRFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571362_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571364_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571365_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571367_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571368_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLPDEGLNRRVAKDLNL--G-N
MG571369_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571370_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEKELPRLADEGLNHRVAEDLNL--G-N
MG571371_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571372_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571373_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571374_Pol_P-B      MPLSYRHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571376_Pol_P-B      MPLSYQHFRKLLLLE--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
MG826153_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MH061283_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MH663473_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MH932712_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MK052964_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK052965_Pol_P-B      MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK075117_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534554_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534571_Pol_P-B      MPLSYQHFRKLPLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534572_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534573_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534576_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534578_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534591_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534599_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534600_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534601_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534602_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534608_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534612_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534614_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534621_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534626_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534627_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534629_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534634_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534658_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534661_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-S
MK534673_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534676_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534680_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534691_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534692_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534693_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534696_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
MK534697_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534698_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534699_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534702_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534703_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534704_Pol_P-B      MPLSYQHFRKLPLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534705_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534707_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534708_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534709_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534710_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534711_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534727_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534732_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534733_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MN689117_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
MN689118_Pol_P-B      MPLSYQHFRKLLLLD--HEAGPLEEELPRLADEGLNRRVAEDLNL--G-T
MN689119_Pol_P-B      MPLSYQCFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLHL--G-T
MN689120_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MN689121_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MN689122_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGFHRRVAEEFHL--G-N
MN689123_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNLRVAEDLNL--G-N
MT111595_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426100_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426101_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MT426102_Pol_P-B      MPLSYQHFRRLVLLD--PEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426103_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426859_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426861_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426864_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426865_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426870_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426873_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426874_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426878_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426879_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426883_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426884_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426887_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426890_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVTEDLNL--G-N
MT426891_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426892_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426896_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426901_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426906_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426908_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426909_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426910_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426911_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426913_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426914_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426915_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426918_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426919_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426920_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426924_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426926_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426927_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426929_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426932_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426936_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426937_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426938_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426939_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426940_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426941_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426942_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426943_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426945_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426946_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426947_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426948_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426950_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426951_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRIADEGLNRRVAEDLNL--G-N
MT426953_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426954_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426956_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426961_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426962_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426963_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426964_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426965_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426966_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426967_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426969_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426970_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426971_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426972_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426973_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426974_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426975_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426976_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426977_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426979_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426981_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426982_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426986_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426988_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426989_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426990_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426991_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426992_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426993_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426994_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426995_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426996_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426998_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426999_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427001_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427002_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRIADEGLNRRVAEDLNL--G-N
MT427004_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427005_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427006_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427008_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427009_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLKL--G-N
MT427012_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427014_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427015_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427017_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427018_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427019_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427020_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427023_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427025_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427028_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427029_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427031_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427032_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427034_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427035_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427036_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427038_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427042_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427045_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427050_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427052_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427058_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427059_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427062_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427063_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427064_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427065_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427069_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427070_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427071_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427078_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427080_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427081_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427086_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427088_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427090_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427091_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427092_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427093_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427094_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427095_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427097_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427098_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427099_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427101_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427102_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427103_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427104_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427108_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT622522_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
MT645001_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MT645016_Pol_P-B      MPLSYQHFRKLLLLD--EGVGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT645018_Pol_P-B      MPLSYQLFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT645025_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT645041_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT645057_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757437_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757438_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757439_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757440_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757441_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757443_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757444_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757445_Pol_P-B      MPLSYPHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757446_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757448_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757449_Pol_P-B      MPLSYPHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757450_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757451_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757452_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757455_Pol_P-B      MPLSYPHFRRLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757456_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW310261_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW310262_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW310263_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW310264_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW497299_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845288_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845289_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVADDLTL--G-N
MW845290_Pol_P-B      MPLSYQHFRKLLLLE--DDAGPLEEELPRLADEGLNRRVAEDLLL--G-D
MW845292_Pol_P-B      MPLSYQHFRKLLLLE--GDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845293_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845294_Pol_P-B      MPLSYQHFRRLLLLE--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845295_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845296_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845298_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845299_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-D
MW845300_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845301_Pol_P-B      MPLSYPHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW845302_Pol_P-B      MPLSYPHFRKLLLLE--DVAGPLEEELPRLADEGLNRRVAEDLGL--G-N
MW845303_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845304_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW845305_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEELNL--G-N
MW845306_Pol_P-B      MPLSYQHFRKLLLLD--TEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845308_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845309_Pol_P-B      MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845310_Pol_P-B      MPLSYQRFRKLLLLE--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845311_Pol_P-B      MPLSYQRFRKLLLLE--DGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW845312_Pol_P-B      MPLSYQHFRKLLLLE--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW887648_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW999602_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW999603_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999604_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999605_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW999606_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999607_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999608_Pol_P-B      MPLSYQHFRKLLLLE--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MW999609_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999610_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999611_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MW999612_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLAEEGLNRRVAEDLGL--G-T
MW999614_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999615_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MW999616_Pol_P-B      MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ439517_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439518_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439519_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439521_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439522_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439523_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439524_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439525_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439526_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439528_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439530_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439531_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439532_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-I
MZ439533_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439534_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439535_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439536_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439537_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439539_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MZ439540_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MZ439541_Pol_P-B      MPLSYQHFRKILLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MZ439542_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439543_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439544_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MZ439545_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439546_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439547_Pol_P-B      MPLSYQHFRKILLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-T
MZ439549_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439550_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439551_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ671236_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ671237_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ671239_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675786_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675794_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675795_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675796_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675797_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675798_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGFNHRVAEDLNL--G-N
MZ675799_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675800_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGFNHRVAEDLNL--G-N
MZ675801_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675802_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675803_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ675804_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGFNHRVAEDLNL--G-N
MZ675805_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675806_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ675807_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ934423_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MZ934426_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934427_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934428_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MZ934429_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MZ934430_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
MZ934435_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934436_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934438_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
OK106254_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
OM688314_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
OM688315_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
OM688316_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
ON402775_Pol_P-B      MALSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
ON402778_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
X97850_Pol_P-B        MPLSYQHFRKMLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
X98077_Pol_P-B        MPLSYQHFRKLLLLD--KEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB195935_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB287328_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AB302944_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AB302945_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AF121245_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
AF121246_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
X97851_Pol_P-B        MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY163870_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY217358_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
AY800392_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306697_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
GU815620_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815621_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815626_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815632_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815633_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815646_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815647_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815649_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815652_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815653_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815659_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815660_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815664_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815665_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815666_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815668_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815669_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815674_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815675_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815676_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ688405_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KC510647_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173365_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JN792895_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADDDLNRRVAEDLNL--G-N
JN792899_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNHRVAEDLNL--G-N
JN792898_Pol_P-B      MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNL--G-N
JN792893_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEDLNLRVAEDLNL--G-N
MT427016_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427021_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427022_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427024_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427026_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427027_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427030_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427037_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427039_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427041_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427043_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427046_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427047_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427048_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427049_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427051_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427053_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427054_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427055_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427056_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427057_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427060_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427066_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427067_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427068_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306680_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU306706_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
EU330990_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
FJ899791_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEELNL--G-N
GU815553_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815556_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815564_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815559_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815562_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815563_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815566_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815568_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815575_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815569_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815567_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815576_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815577_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815583_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815584_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815585_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815589_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815590_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815591_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815593_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815595_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815597_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815603_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815605_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815606_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815609_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815611_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815612_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815613_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815614_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815622_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815628_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815629_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815630_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815631_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815636_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815637_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815643_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815644_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815645_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MG571322_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815680_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815681_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815685_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815686_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815687_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815688_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815689_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815691_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815692_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815693_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815694_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815696_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815697_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815698_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815700_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815705_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815708_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815702_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815709_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815710_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815717_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815719_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815732_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815734_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815736_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815737_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815738_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815740_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815741_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815742_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815744_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815746_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815748_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815751_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815754_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815756_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815757_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815762_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815766_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815767_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815768_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815771_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815764_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815775_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815781_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
GU815776_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ027331_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
JQ341599_Pol_P-B      MPLSYQHFRKLLLLD--DXAGPLEEELPRLADEGLNRRVAEDLNL--G-N
JQ707737_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707743_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707749_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707758_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707759_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707764_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707745_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707746_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707766_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707755_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
JQ707767_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
KJ803756_Pol_P-B      MPLSYQHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803758_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803764_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADKGLNRRVAEDLNL--G-N
KJ803768_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
KJ803773_Pol_P-B      MPLSYPHFRRLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLGL--G-N
KJ803775_Pol_P-B      MPLSYPHFRKLLLLD--QEAGPLEEELPRLADEGLNRRVAEDLGL--G-N
KJ803783_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ803784_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803786_Pol_P-B      MPLSYQHFRKILLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803763_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803781_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ173340_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173345_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173354_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173364_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173415_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173413_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173388_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173390_Pol_P-B      MHLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173398_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPHLADEGLNRRVAEDLNL--G-N
KJ173400_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADDGLNRRVAEDLNL--G-N
KJ173402_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173406_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173408_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173410_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173412_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173417_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173419_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173421_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ173423_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803789_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803795_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVADDLNL--G-N
KJ803796_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803801_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803805_Pol_P-B      MPLSYQHFRKLVLLD--EEAGPLEEELPRLADEGLNRRVAEELNL--G-N
KJ803808_Pol_P-B      MPLSYQHFRKLLLLD--KDAGPLEDELPRLADEGLNRRVAEDLTL--G-N
KJ803816_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRFAEDLNL--G-T
KJ803817_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803819_Pol_P-B      MPLSYQHFRKLLLLD--NEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803820_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803821_Pol_P-B      MPLSYQRFRKLLLLD--TDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803824_Pol_P-B      MPLSYQHFRKLLLFD--NAAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KJ803825_Pol_P-B      MPLSYQRFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148320_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148328_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148338_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148339_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148344_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148346_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148347_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MK534570_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148364_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148451_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148376_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148388_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148396_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148386_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148398_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148433_Pol_P-B      MPLSYQHFRKLLLLD--DDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148413_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148421_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP148427_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406180_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406178_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406183_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406184_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406185_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406189_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406191_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406192_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406193_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406196_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406198_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406204_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406205_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406208_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406209_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406210_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406213_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406214_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406215_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406218_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406199_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406195_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406200_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406217_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406212_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406216_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406219_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406202_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406207_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406211_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406221_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406222_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406223_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406224_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406225_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406226_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406227_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406228_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406230_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406231_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406243_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406235_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406242_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406240_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406247_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406248_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406250_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406254_Pol_P-B      MPLSYQHFRKLLLLD--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406268_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406294_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406312_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406314_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406308_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406309_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406310_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406313_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406315_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406316_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406321_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406324_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406326_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406328_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406323_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406329_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KP406334_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MF674483_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963800_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963801_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963802_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963803_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963804_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963805_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963806_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963807_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963808_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963809_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963810_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963811_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963812_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963813_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963817_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963818_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963819_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963820_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963821_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963822_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963823_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963824_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963825_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963826_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963827_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963830_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963831_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963832_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963833_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963836_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963837_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963838_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963839_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963840_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963855_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963844_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963845_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963846_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963847_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963848_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963849_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963850_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963851_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963852_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963947_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963950_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963952_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963954_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963956_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963959_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963955_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963961_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963966_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963969_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963972_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963973_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963975_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963963_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963977_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963978_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963979_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963982_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963983_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963984_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963985_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963986_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963988_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU963989_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964081_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964082_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964085_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964086_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964087_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964089_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964091_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964092_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964099_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964100_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964107_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964113_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964120_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964125_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964127_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964128_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964129_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964132_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964133_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964134_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964142_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964144_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964145_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964147_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964148_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964151_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964161_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964160_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964163_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964252_Pol_P-B      -------FRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964256_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964264_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964266_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964268_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964270_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964263_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964271_Pol_P-B      MPLSYQHFRKLLLLD--EGAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964275_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964276_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964279_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964280_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964284_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964285_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964286_Pol_P-B      MPLSYQHFRKLLLLEEGEEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964288_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964289_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964290_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964293_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964294_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964295_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964297_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964298_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964301_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-D
KU964382_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964383_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964384_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964385_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964388_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964391_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964393_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964395_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KU964397_Pol_P-B      MPLSYQHFRNVLLLG--EDAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470840_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470837_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY470839_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881722_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881723_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881724_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881725_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881726_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881727_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881728_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881729_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881730_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881731_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881732_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881733_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881734_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881735_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881740_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881741_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881745_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881746_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881747_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881752_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881753_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881756_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881757_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881759_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881760_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881761_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881778_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881779_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881901_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881902_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881903_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881897_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
KY881913_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
LC279270_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
LC279271_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MT426860_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426862_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426863_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426867_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426868_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426869_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426871_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426872_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426875_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426876_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426877_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426880_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426881_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426882_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426885_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426886_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426888_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426889_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426893_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426894_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426895_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426897_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426900_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426902_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426903_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426904_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426866_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426898_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426899_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426905_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEDELPRLADEGLNRRVAEDLNL--G-N
MT426907_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426912_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426916_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426917_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426922_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426923_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426925_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426933_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426934_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426944_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426960_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427003_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426921_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426931_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426935_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426959_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426985_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426928_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426952_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426980_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426984_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426987_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427000_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426957_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426958_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426968_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426978_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426983_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427013_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426949_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426955_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT426997_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427007_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427010_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427011_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427061_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427072_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427073_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427074_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427075_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427076_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427077_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427079_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427082_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427083_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427084_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427085_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427087_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427089_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427100_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427106_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427107_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT427109_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT645058_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757454_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757453_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MT757457_Pol_P-B      MPLSYPHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934437_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ439520_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439527_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ439529_Pol_P-B      MPLSYQHFRKLLLLD--DEAGPLEEELPRLADEGLNHRVAEDLNL--G-N
MZ934439_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
MZ934440_Pol_P-B      MPLSYQHFRKLLLLD--EEAGPLEEELPRLADEGLNRRVAEDLNL--G-N
                                            * .    :    :    :          

MK534603_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964109_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MT427105_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341582_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCEQF
MT426104_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
HM011477_Pol_P-B      LDVXIPWTHKVGNFTGLYSSTVPCFNPBWQTPSFPDIHLQEDIVDRCQQF
FJ386669_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLQEDIVDRCKQF
KJ173297_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQY
HM011467_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPXFNPXWQTPSFPDIHLXEDIINRCTEF
KX276771_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCZQX
GQ377547_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073825_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPAFPDIHLQEDIVDRCKQF
KX276811_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIIDRCEQF
HM011478_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQF
KC792896_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993711_Pol_P-B      LNVRIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLXEDIVDRCKQF
MF674419_Pol_P-B      LNVSIPWTHKVGNFTGLYSSRVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
EU939661_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306696_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276798_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNSXWQTPSFPDIHLXEDIVDRCZQF
KU964291_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406292_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KX276774_Pol_P-B      LNASIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLQEDIVDRCKQF
KC792881_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTISCFNPNWQTPSFPDIHLKEDIIDRCEQF
KY881947_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLHEDIVDRCKQF
KJ717820_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCMQF
KP148342_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148583_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX026886_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963946_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MG571326_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCKQF
KC792811_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCXQF
JQ341596_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPNFNPBWQTPSFPDIHLREDIVDRCEQF
MK534694_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ173384_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KC793038_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JX429897_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793066_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPXFNPXWQTPSFPDIHLQEDIVDRCKQF
AF461360_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KU964118_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793042_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB212626_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
KP406318_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793125_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVERCKQF
MF674391_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ358140_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPKWQTPSFPDIHLQEDIVNRCKQF
KJ717792_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCKQF
KC792719_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPBIHLXEDIVDRCKQF
KC793128_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MW999613_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIADRCKQF
KJ803787_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCKQF
GQ358146_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLKEDIVNRCTQF
KX276783_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPXFPDIHLQEDIVDRCKQF
KP406284_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JF436921_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KY881869_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
MT427033_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717807_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDLINRCEQF
KM213036_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLKEDIVDRCKQF
MK534659_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPDIHLREDIVNRCEQF
KP659255_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
KX276796_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KY470962_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
KC793064_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
GU815780_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCKQF
JQ429081_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCKQF
KM875417_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX870001_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
KJ790200_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KU964302_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP148419_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCEQF
JQ040157_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276858_Pol_P-B      XXVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIIDRCKQF
EU881998_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386656_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU522074_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924606_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDLVDRCKQF
KJ173389_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU305547_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC793106_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY217361_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCEQF
FJ899787_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792761_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCXQF
AB073823_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
DQ377158_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276827_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPXWQTPSFPDIHLQEDIINRCEQF
AF121251_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCQQF
MT427040_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MK818223_Pol_P-B      VNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLKEDIVDRCKQF
MG826152_Pol_P-B      LNVSIPWTHKVGNFTGLYSSKVPVFNPEWQTPSFPHIHLKEDIITRCQQF
MK534575_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQY
JQ801507_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ358145_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCKQF
EU939639_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCRQF
AB073838_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIVDRCKQF
EF494381_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPEWQTPSFPNIHLQEDIVDGCKQF
LC603638_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
KY881794_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341554_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCNQF
JX504533_Pol_P-B      LNVSIPWTHKVGNFTGLYSSKVPCFNPKWQTPSFPDIHLQEDIVERCKQY
KJ803797_Pol_P-B      LNLSIPWTHKVGNFTRPYSSTVPRFNPKWQTPSFPDIHLQEDIVDRCKQF
MT427096_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306704_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KC774370_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQF
HM011473_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCQQF
KC792649_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AY217359_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MW845307_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLKEDIVDRCTQF
AB073839_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AY800389_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964287_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MW845291_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
AB302095_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIDRCKNF
GQ924611_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPFFPDIHLQEDIVDRCKQF
KP148318_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDGCKQF
MZ439548_Pol_P-B      LNVDIPCTHRVGNFTGLYSSTVPIFNPDWQTPSFPDIHLQEDIVDRCEQF
JX661472_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173424_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVNRCKQF
KX276786_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPNWXTPSFPDIHLKEDIVDRCKQF
FJ787477_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792949_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
ON402781_Pol_P-B      INVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
MZ671238_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
AB246341_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
KU964278_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KU964267_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AB900111_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
MT645005_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
KU964283_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC792667_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KY881801_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276797_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPBWQTPXFPDIHLREDIVDRCTQF
EF494380_Pol_P-B      LNVSIPWTHKVGNFTGLYSSKVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MK534611_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ995804_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCEQF
AB931169_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKEF
KC792976_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPBWKXPSFPDIHLQEDIVDRCXQF
KC792920_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPBIHLQEDIVDRCKQF
MK052962_Pol_P-B      LNVSIPWTHKVGNLTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY167093_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KC774369_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQF
DQ993708_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774368_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ361535_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCKQF
KC792770_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
AB900107_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AY596112_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ995802_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQPPSFLDIHLREDIVDRCKQF
MZ439538_Pol_P-B      LNVNIPCTHRVGNFTGLYSSTVPIFNPDWQTPSFPDIHLQEDIVDRCEQF
KJ173383_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPNIHLQEDIVDRCKQF
KU964299_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ717837_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLREDIVDRCEQF
KX276792_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLXEDIVDRCKNF
AB642093_Pol_P-B      PNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
KJ173411_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792955_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ717813_Pol_P-B      LNASIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQY
KC774379_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDKCKQF
MZ675785_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406188_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MG571351_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQENIVDRCEQF
MW845297_Pol_P-B      LNVEIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLQEDIVDRCKQF
KU964292_Pol_P-B      LNVSSPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AB246342_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIVDRCKQF
EU306679_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KF053174_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
AY217368_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964296_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU939677_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
GQ377644_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLREDIVDRCKQF
KX276779_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MK534683_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQF
JN792900_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
FJ386636_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173418_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MW845286_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
FJ386660_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKHF
KU964269_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406333_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
D50521_Pol_P-B        LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDLIDRCKQF
DQ463790_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KC792897_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
LC279269_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPDIHLQEDIVDRCKQF
MG571358_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCQQF
AY217357_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964300_Pol_P-B      LNVSIPWTHKVGNFAGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
MF674426_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276809_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCEQF
KJ173298_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDILNRCQQY
JQ341565_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596111_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073849_Pol_P-B      PNVXIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLXEDIVDRCQQF
KX276825_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIIDRCKQF
KP148341_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MT427044_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377566_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
MT757436_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVDRCKQF
KC774404_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY206390_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLKEDIVDRCEQF
KP148359_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KX276778_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964265_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KX276772_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPBIHLXEDIVDRCKQF
KC793199_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792859_Pol_P-B      PNVSIPWTHKVGNFTGLYSSKVPCFNPEWQTPSFPNIHLQEDIVDRCKQF
HM011484_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ562224_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ924635_Pol_P-B      VNVSILWRHKGRNFTGLYSSTVPIFNPEWQTPSFPDIHLQEDIVDRCKQF
KU964381_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939559_Pol_P-B      LNVSIPWTHKVGNFTGLYSSKVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
AB010289_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIDRCKQF
AB010290_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB010291_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB010292_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB014366_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB031267_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB033554_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIIDKCKQF
AB033555_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCNQF
AB073821_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073822_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073824_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AB073826_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073827_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073828_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073829_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073830_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
AB073831_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073832_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCXQF
AB073833_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073834_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073835_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB073836_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWKTPSFPDIHLQEDIVDRCKQF
AB073837_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLREDIVDRCKQF
AB073840_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB073841_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
AB073842_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073843_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073844_Pol_P-B      PNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073845_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073846_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVNRCKQF
AB073847_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073848_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPDIHLQEDIVDRCKQF
AB073850_Pol_P-B      PNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073851_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073852_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIVDRCEQF
AB073853_Pol_P-B      PNVDIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCQQF
AB073854_Pol_P-B      PNVDIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCEQF
AB073855_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073857_Pol_P-B      PTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB073858_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB100695_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB106884_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCEQF
AB115551_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPDIHLQEDIVDRCKQF
AB117759_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB195933_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB195934_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB205119_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB205120_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB205121_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB205122_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIIDRCQQF
AB212625_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB219426_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVDRCKQF
AB219427_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFPNIHLQEDIVDRCKQF
AB219428_Pol_C-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVDRCKQF
AB219429_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGYNPEWQTPSFPDIHLQEDIVDRCKQF
AB219430_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCKQF
AB231909_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
AB241117_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVDRCKQF
AB246339_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB246340_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB246343_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIVDRCKQF
AB287314_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCKQF
AB287315_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCKQF
AB287316_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCKQF
AB287317_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCEQF
AB287318_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCKQF
AB287319_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
AB287320_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
AB287321_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCTQF
AB287322_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
AB287323_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQF
AB287325_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
AB287326_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCEQF
AB287327_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPDIHLQEDIVDRCKNF
AB287329_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
AB300364_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB300371_Pol_P-B      PNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB302942_Pol_P-B      LNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AB302943_Pol_P-B      LNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AB362933_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVERCKQF
AB365445_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB368295_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNSDWQAPSFPDIHLQEDIVNRCKQF
AB471854_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB471855_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB493827_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCEQF
AB493833_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AB493835_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPNWQTPSFPDIHLQEDIINRCKQF
AB555498_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDNHKQENIVDRCEQF
AB555499_Pol_P-B      PNVSIPWTHKVGNFTGLYSSSVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
AB642094_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AB642101_Pol_P-B      PNVSIPWTHRVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQENIVDRCQQF
AB675676_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AB713527_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AB713528_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPIFNPKWQTPSFPDIHLQEDIVNRCKQF
AB713531_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
AB713532_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AB828708_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCTQF
AB900095_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKEF
AB900096_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB900097_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB900098_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB900102_Pol_P-B      PNVGIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIVDRCKQF
AB900103_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIVDRCEQF
AB900104_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPDIHLQEDIVDRCEQF
AB900105_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB900106_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
AB900108_Pol_P-B      PDVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPDIHLQEDIVDRCKQF
AB900110_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
AB900112_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIVDRCKQF
AB931168_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKEF
AF100308_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AF100309_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKGQTPSFPDIHLQEDIVDRCKQF
AF121243_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AF121244_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AF121247_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AF121248_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AF121249_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AF121250_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCEQF
AF282917_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AF282918_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
AF479684_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AJ627225_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCNQF
AP011084_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AP011085_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCKQF
AP011086_Pol_P-B      LNVSIPWTHXVGNFTGLYSSTVPGFNPDWQTPSFPDIHLQEDIVDRCKQF
AP011087_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFPDIHLQEDIVDRCKQF
AP011088_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AP011089_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPBWQTPSFPDIHLQEDIVDRCKQF
AP011090_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AP011091_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
AP011092_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCKQF
AP011093_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQF
AP011094_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFPDIHLQEDIVNRCEQF
AP011095_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQF
AP011096_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPDWQTPSFPDIHLQEDIVDKCKQF
AY033072_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIADRCKQF
AY033073_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIADRCKQF
AY163869_Pol_P-B      VNVSIPWTHKVGNFTELYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY167089_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY167094_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLXEDIVDRCKQF
AY167097_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY167098_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY167100_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY167101_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY167102_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AY206373_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY206375_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY206383_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQPPSFPDIHLREDIVDRCKQF
AY206391_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCNQF
AY217355_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AY217356_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
AY217360_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY217362_Pol_P-B      LNVSIPWAHKVGNFTGLYSSTVPCFNPQWQTPSFPNIHLQEDIVDRCKQF
AY220697_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY220698_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY220703_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY220704_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY293309_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY518556_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596102_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596103_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY596104_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596105_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY596106_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596109_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
AY596110_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
AY766463_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPHIHLQEDIVDRCKQF
AY800391_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLHEDIINRCKQF
D00329_Pol_P-B        PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
D00330_Pol_P-B        LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
D00331_Pol_C-B        LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINKCKQF
D23678_Pol_P-B        PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPDIHLQEDIVDRCKQF
D23679_Pol_P-B        PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCKQF
D50522_Pol_P-B        LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDLIDRCKQF
DQ448619_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448620_Pol_P-B      LNVSIPGTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448621_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448622_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448623_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448624_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448625_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448626_Pol_P-B      LNVSIPGTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448627_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ448628_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
DQ463787_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQF
DQ463788_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCQQF
DQ463789_Pol_P-B      PNVSIPWTHKVGNFAGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
DQ463791_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQPPAFPNIHLQENIIDRCEQF
DQ463792_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCQQF
DQ463793_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCQQF
DQ463794_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
DQ463795_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQF
DQ463796_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCQQF
DQ463797_Pol_P-B      PNVSIPWTHKVGNFAGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
DQ463798_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
DQ463799_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCTQF
DQ463800_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
DQ463801_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCQQF
DQ463802_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCQQF
DQ904357_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ975271_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVNRCKQF
DQ993680_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
DQ993681_Pol_P-B      LNVNIPWTHKVGDFAGLYSSMVPNFNPDWQTPSFPDIHLQEDIVDRCKHF
DQ993683_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDLVDRCKQF
DQ993684_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDGCKQF
DQ993685_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ993686_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEEIVDRCKQF
DQ993697_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993698_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993699_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993700_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQY
DQ993701_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQY
DQ993702_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993703_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993704_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993705_Pol_P-B      LNDNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ993706_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
DQ993707_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLEEDIVDRCKQF
DQ993709_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ993710_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
DQ995801_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLKEDIVDRCKQF
DQ995803_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EF134945_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EF134946_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EF473971_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
EF473972_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
EF473973_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLQEDIVDRCEQF
EF473974_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EF473975_Pol_P-B      LNVSIPWTHKVGNFTGLYSSKVPCFNPKWQTPSFPDIHLQEDIINRCEQF
EF473976_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCEQF
EF473977_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
EU139543_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU158262_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
EU158263_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLQEDIVDRCSQF
EU305548_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU306677_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306678_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306681_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306695_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306699_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306700_Pol_P-B      LNVSIPWAHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306701_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306702_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306703_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306705_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306707_Pol_P-B      LNVSIPWTHKVGNFTGLHSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306708_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306709_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306710_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306711_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU306712_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU330989_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPDIHLQEDIVNRCKQF
EU330995_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPDIHLQEDIVNRCKQF
EU330996_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCKQF
EU330997_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPDIHLQEDIVNRCQQF
EU439018_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFPDIHLQEDIVDRCKQF
EU439020_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFPDIHLQEDIVDRCKQF
EU439021_Pol_P-B      LNASIPWTHKVGNFTGLYSSTVPCFNPMWQTPSFPDIHLQEDIVDRCKQF
EU439022_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPMWQTPSFPDIHLQEDIVDRCKQF
EU439023_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPIWQTPSFPDIHLQEDIVDRCKQF
EU487256_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
EU487257_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU522067_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQIPSFPDIHLQEDIVDRCKQF
EU522072_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
EU547563_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCEQF
EU564822_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU564823_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU564824_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU564826_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLKEDIVDRCEQF
EU570069_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU570070_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU570071_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU570075_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCKQF
EU579441_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU589335_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU595031_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
EU796066_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU796067_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU796068_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQENIVDRCKQF
EU881997_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU882002_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU882004_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU919171_Pol_P-B      LDVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLKEDIIDRCEQF
EU919172_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU919173_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU919175_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
EU919176_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
EU939633_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
EU939634_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
EU939636_Pol_P-B      PNVSIPWTHKVGSFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
EU939638_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939663_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939664_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU939665_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU939666_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939667_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
EU939669_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939670_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
EU939671_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939672_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939673_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
EU939674_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLKEDIVDRCEQF
EU939675_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLKEDIVDRCEQF
EU939676_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
EU939678_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQF
EU939679_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ023631_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ023632_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPGWQTPSFPDIHLQEDIVDRCKQF
FJ023633_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
FJ023634_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
FJ023635_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCQQF
FJ023636_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
FJ023637_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLREDIVNRCKQF
FJ023638_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLREDIVNRCKQF
FJ032342_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLKEDIVDRCKQF
FJ032344_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCKQF
FJ032352_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIIDRCKQF
FJ032353_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIIDRCEQF
FJ032354_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIIDRCKQF
FJ032357_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ032358_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ349236_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
FJ386582_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386583_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386584_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386600_Pol_P-B      LNVSIPWTHKVGNFTGLYSSSVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
FJ386608_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
FJ386610_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386615_Pol_P-B      LNVSVPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPNIHLQEDIVDRCKQF
FJ386634_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNAKWQTPSFPDIHLQEDIVDRCKQF
FJ386642_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNSKWQTPSFPDIHLQEDIVDRCKQF
FJ386648_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ386654_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386655_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386658_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKNF
FJ386666_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ386668_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386675_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPAFPDIHLQEDIVDRCKQF
FJ386676_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
FJ386680_Pol_P-B      LDVSIPWTHKVGNFTGLYSSKVPCFNPEWQTPSFPDIHLQEDIIDRCERF
FJ386681_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ386682_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLREDIVDRCKQF
FJ386683_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386684_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ386688_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ518812_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562219_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562222_Pol_P-B      LNVSIPWTPKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCEQF
FJ562231_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVNRCEQF
FJ562234_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ562236_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562237_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
FJ562240_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562246_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562253_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562254_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562257_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562259_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
FJ562260_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
FJ562289_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562296_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ562303_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562311_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
FJ562312_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ562316_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ562321_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
FJ562322_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ787444_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ787475_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ787476_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
FJ899779_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIADRCKQF
FJ899784_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ899785_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
FJ899790_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLKEDIVDRCEQF
GQ358136_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCKQF
GQ358137_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFPDIHLQEDIVNRCKQF
GQ358138_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
GQ358139_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
GQ358141_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCKQF
GQ358142_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCTQF
GQ358143_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCKHF
GQ358144_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCKQF
GQ358147_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLKEDIVNRCKQF
GQ358148_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFPDIHLQEDIVDRCKQF
GQ358149_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPDFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ358150_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFPDIHLREDIVDRCKQF
GQ358151_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFPDIHLQEDIVDRCKQF
GQ358152_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPDFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377519_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377525_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377537_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377542_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377550_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377558_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377561_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377567_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ377568_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCKQF
GQ377569_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377582_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
GQ377587_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ377588_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377606_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377610_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377612_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377622_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377625_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377629_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377638_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377639_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377641_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ377643_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ475340_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924603_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLHEDIVDRCKQF
GQ924605_Pol_P-B      LNVSIPWTHKVGNFTGLYXSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924607_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924608_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924610_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GQ924617_Pol_P-B      LHVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIINRCKQF
GQ924621_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPNIHLQEDIVNRCKQF
GQ924624_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHMQEDIVDRCKQF
GQ924625_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVHRCEQF
GQ924626_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKRF
GQ924627_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924628_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924630_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ924631_Pol_P-B      LNVSIPWTHKVGNFTGLYSXTVPCFNPKWQTPSFPDIHLQEDIVDRCNQF
GQ924632_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ924634_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924637_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPNWQTPSFPDIHLQEDIINRCKQF
GQ924638_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
GQ924639_Pol_P-B      LNVSIPWTHKVGNLTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
GQ924640_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVDRCRQF
GQ924641_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCEQF
GQ924644_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924645_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPNIHLQEDIVDRCKQF
GQ924646_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GQ924647_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924648_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924651_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924653_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924654_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCKQF
GQ924656_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIINRCKQF
GU357842_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNTNWQTPSFPDIHLQEDIVDRCKQF
GU434372_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU434373_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU451682_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815548_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815549_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815550_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815551_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815552_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815554_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815555_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815557_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815558_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815560_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815561_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815565_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815570_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815571_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815572_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815573_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815574_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815578_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
GU815579_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815581_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815586_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815587_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815588_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815594_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815596_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815598_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815599_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815601_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815602_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQGDIVDRCKQF
GU815604_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815607_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815608_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815610_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815616_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815617_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815618_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815619_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815623_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815624_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815625_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815627_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815634_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815635_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815638_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815639_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815640_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815641_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815642_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815648_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815650_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815651_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815654_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815656_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815657_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815658_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815661_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815662_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815663_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815667_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815670_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815672_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815673_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815677_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815678_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815679_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815683_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815684_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815695_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815699_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815701_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815703_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815704_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815706_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815707_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815711_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815712_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815713_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815715_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815716_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815718_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815720_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815721_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815722_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815723_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815724_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815725_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815726_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815727_Pol_P-B      LNVSIPWTHKVGNFTGLYSSMVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815728_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815729_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815730_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815731_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815733_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815735_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815739_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815743_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815745_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
GU815747_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815749_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815750_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815752_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815753_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815755_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815759_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815760_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815761_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815765_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815769_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815770_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815772_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815773_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815774_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815777_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815778_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815779_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815782_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
GU815783_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
HM011466_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
HM011469_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLXEDIIDRCKQF
HM011470_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCZQF
HM011471_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNTEWQTPSFPNIHLQEDIVDRCKQF
HM011474_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKQF
HM011475_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCQQF
HM011476_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
HM011480_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
HM011482_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
HM011483_Pol_P-B      LNXSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
HM011487_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPEWQTPSFPDIHLQEDIVNRCEQF
HM011490_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIIHRCEQF
HM011492_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPBIHLQEDIIBRCKQF
HM011494_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
HM011496_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIVDRCEQF
HM011499_Pol_P-B      PXVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIIDRCKQF
HM011503_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPBIHLQEDIVDRCKQF
HM011504_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLXEDIVDRCEQF
HM153811_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
HQ700546_Pol_P-B      INVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
HQ700548_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCKQF
HQ700549_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPKWQTPSFPDIHLQEDIINRCEQF
JF412801_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JF899335_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JN406371_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JN792894_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCQQF
JN792896_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
JN792897_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
JN792901_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
JN792902_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCEQF
JN827419_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ027311_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPSFNPXWQTPSFPBIHLQEDIINRCEQF
JQ027312_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLXEDIVDRCZQF
JQ027313_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPNIHLQEDIXDRCKQX
JQ027315_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
JQ027316_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVNRCEQF
JQ027325_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
JQ027330_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCNQF
JQ027334_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPQFNPNWQTPSFPDIHLQEDIVXRCEQF
JQ040125_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040128_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040138_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040147_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040170_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040171_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ040173_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341549_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCQQF
JQ341550_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341551_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341552_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341553_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341555_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341556_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
JQ341557_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCXQF
JQ341558_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341559_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341560_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKQF
JQ341561_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JQ341562_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JQ341563_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341564_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341566_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341567_Pol_P-B      LNVBIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPBIHLQEDVIDRCEQF
JQ341568_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341569_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341570_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKLF
JQ341571_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIVDRCRQF
JQ341572_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPRFNPKWQTPSFPVIHLQEDIVDRCEQF
JQ341573_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JQ341574_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341575_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKHF
JQ341576_Pol_P-B      VNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
JQ341577_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341578_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341579_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCNQF
JQ341580_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341581_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLREDIVDRCKQF
JQ341583_Pol_P-B      LNVSIPWTHKXGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341584_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTIPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JQ341585_Pol_P-B      LTVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341586_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341587_Pol_P-B      INVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
JQ341588_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIXDRCKQF
JQ341589_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341590_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPXFNPKWQTPSFPDIHLQEDIVNRCEQF
JQ341591_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341593_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
JQ341594_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ341595_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
JQ341597_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
JQ341598_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
JQ341600_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
JQ341601_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341603_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341604_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341605_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
JQ341606_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLXEDIVDRCKQF
JQ341607_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
JQ341608_Pol_P-B      LNVXIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLXEDIVDRCKQF
JQ341609_Pol_P-B      LNVSIPWTHKXGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ429082_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLKEDIINRCEQF
JQ707734_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707735_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707738_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707739_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707740_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707742_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707744_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707747_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707750_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707753_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707762_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIQLKEDIVDRCKQF
JQ707763_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ707765_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLKEDIVDRCKQF
JQ801471_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801474_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JQ801479_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801494_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCEQF
JQ801506_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801512_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801514_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801516_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JQ801524_Pol_P-B      LNVSIPWTHKVGNFTGLYSFTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX026879_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX026881_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKQF
JX026883_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX429899_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX429900_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX429901_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JX429902_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JX429908_Pol_P-B      FNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX429910_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX429911_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX504532_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JX504538_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
JX504543_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
JX507210_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX507213_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX507215_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661470_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661471_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661473_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661474_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661475_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661476_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661478_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661479_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661480_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661481_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661482_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661483_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX661484_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFPDIHLQEDIVDRCKQF
JX869998_Pol_P-B      LNVSIPWTHKVGNFTGLYSATVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
JX869999_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQX
JX978431_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC492739_Pol_P-B      LTVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510641_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510642_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510643_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC510644_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510646_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510648_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC510649_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510650_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510651_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510652_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC510653_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510654_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510655_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510656_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510657_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510658_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510659_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC510660_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC774362_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCRQF
KC774363_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCRQF
KC774365_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774366_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774367_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774371_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774372_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774373_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774374_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774375_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774376_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC774377_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC774378_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774380_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPKWQTPSFPDIHLKEDIVDRCKQF
KC774381_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774382_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCRQF
KC774383_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774384_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774385_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774386_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774387_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCKQF
KC774388_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774389_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774390_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774391_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCRQF
KC774392_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774393_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774394_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774395_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
KC774396_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQF
KC774397_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774398_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774399_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774400_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774401_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774402_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774403_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774405_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKRF
KC774406_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC774407_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774408_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774409_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774410_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KC774411_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774412_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774413_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KC774415_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774416_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774417_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC774418_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLHEDIVNRCKQF
KC774419_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQF
KC792652_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC792663_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC792674_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792681_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792701_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
KC792712_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792717_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPNIHLQEDIVDRCKQF
KC792742_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792745_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792748_Pol_P-B      LTVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLXEDIVDRCQQF
KC792756_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792765_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792767_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLREDIVDRCEQF
KC792777_Pol_P-B      LNVSIPVTHKVGNFTGLYSSTVPCFNPHWQTPSFPDIHLQEDIVDRCEQF
KC792780_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792786_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792798_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCKQF
KC792800_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEXF
KC792815_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792843_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792844_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNXNWQTPSFPDIHLQEDIVDRCXQF
KC792847_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCTQF
KC792860_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFSDIHLQEDIVDRCKQF
KC792885_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792889_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLKEDIVDRCKQF
KC792892_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792901_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCNQF
KC792904_Pol_P-B      XNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCXQF
KC792935_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCEQF
KC792936_Pol_P-B      LNVDIPWTHKVGNFTGLYSSTVPXFNPTWQTPSFPNIHLQEDIVDRCXQF
KC792938_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC792939_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCXQF
KC792945_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792946_Pol_P-B      LDVSXPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCEQF
KC792947_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCEQF
KC792948_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792959_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792970_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPXIHLQEDIVDRCXQF
KC792973_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC792974_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
KC792982_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC792985_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCQQF
KC792994_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCKQF
KC793004_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC793006_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCRQF
KC793030_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVDRCEQF
KC793045_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793061_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793069_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KC793076_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQXPSFPDIHLQEDIVDRCKQF
KC793099_Pol_P-B      LTVSIPWTHKVGNFTGLYSSTVPCFNPDWQTPSFPDIHLKEDIVDRCKQF
KC793101_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793115_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793132_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793139_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KC793168_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KC793180_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVBRCQQF
KC793189_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNSNWQTPSFPDIHLQEDIVDRCKQF
KF053159_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNSKWQTPSFPDIHLQEDIVDRCKQF
KF053162_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
KF053163_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCEQF
KF053165_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
KF053171_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KF053180_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIIDRCKHF
KF053182_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIIDRCKHF
KF053189_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KF053190_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCQQF
KF053191_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIIDRCKQF
KF053192_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KF053194_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173339_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173341_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQY
KJ173342_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQY
KJ173343_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KJ173347_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173348_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173351_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCKQF
KJ173352_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173353_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCKQF
KJ173355_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173356_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173357_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173359_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173360_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173361_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173362_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173363_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173366_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173367_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173368_Pol_P-B      LNVSIPWTHKVGSFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173369_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173371_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KJ173372_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KJ173374_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173375_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173376_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173377_Pol_P-B      LNVSIPWTHKVGNFTGLYSSSVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ173378_Pol_P-B      LNVSIPWTHKVGNFTGLYSSSVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ173379_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173381_Pol_P-B      LNVSTPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173382_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173385_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCEQF
KJ173386_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQENIVDRCEQF
KJ173387_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173397_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173399_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173401_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQF
KJ173403_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173405_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173407_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173409_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173414_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173416_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDKCKQF
KJ173420_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173422_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ173425_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPXWQTPSFPDIHLQEDIVNRCKQF
KJ410490_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ410500_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ410502_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ410507_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
KJ410516_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
KJ410517_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPQWQTPSFPDIHLQEDIVDRCKQF
KJ717795_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717796_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717797_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPRFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ717805_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717806_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717808_Pol_P-B      LNLSIPWTHKVGNFTRPYSSTVPRFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717817_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ717818_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ717829_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQF
KJ717831_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQF
KJ717835_Pol_P-B      LNVSIPCTHKVGNFTGLYSSTVPSFNPKWQTPSFPNIHLQEDIINRCEQF
KJ717836_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KJ717840_Pol_P-B      LDVNIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLKEDIINRCKQF
KJ717842_Pol_P-B      LNVRIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KJ717843_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KJ803752_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNSKWQTPSFPDIHLQEDIVDRCKQF
KJ803755_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIINRCEQF
KJ843165_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM213032_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KM213034_Pol_P-B      LNVSVPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM213035_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KM359440_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQX
KM392072_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM392083_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM392084_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM875416_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KM875418_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFSPKWQTPTFPDIHLHEDIVDRCKQF
KM875420_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPNWQTPSFPDIHLQEDIVDRCEQF
KM875421_Pol_P-B      LNVSIPWTHKVGNFTGLFSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP036970_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP148314_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148317_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148319_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148321_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148322_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148323_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148324_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148325_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148326_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP148327_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148329_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148330_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148331_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP148332_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148333_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDFHLQEDIVDRCKQF
KP148334_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148335_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148336_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148340_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148343_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148345_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148348_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148349_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148356_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148357_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148360_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148361_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148362_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148363_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148365_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148366_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148367_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148368_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148369_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148370_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148371_Pol_P-B      LNVSIPGTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148372_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148373_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148374_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148375_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148377_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148378_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148379_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148380_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148382_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148383_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148384_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148385_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148387_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148389_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148390_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148391_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148392_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148394_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148395_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148397_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148399_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148400_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148401_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148402_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148403_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148405_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148406_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148407_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148409_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148410_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148411_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148414_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148415_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148416_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVHRCEQF
KP148418_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148420_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148423_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCEQF
KP148424_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148425_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148426_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCEQF
KP148429_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148430_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCEQF
KP148432_Pol_P-B      LNVSIPWTHKVGDFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148435_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPNIHLQEDIVNRCKQF
KP148437_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148438_Pol_P-B      LDVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148439_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVDRCKQF
KP148440_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPAWQTPSFPDIHLQEDIVNRCKQF
KP148452_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148453_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148455_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148456_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIQLQEDIVNRCTQF
KP148457_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148458_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148459_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148461_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPDIHLQEDIVNRCTQF
KP148579_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148580_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRRKQF
KP148581_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP148582_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPPFPDIHLQEDIVDRCKQF
KP406162_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406163_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406165_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406166_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406167_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406171_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406172_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406173_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406176_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406177_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406179_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406181_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406182_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406186_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406187_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406190_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406194_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406197_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406201_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406203_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406206_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406220_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406229_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406232_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406233_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406234_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPTWQTPSFPDIHLQEDIVDRCKQF
KP406236_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406237_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406238_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406239_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406241_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406244_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406245_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406246_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406249_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406251_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406252_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406253_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KP406255_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406257_Pol_P-B      INVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406258_Pol_P-B      VNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406260_Pol_P-B      INISIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406262_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406263_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406264_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406265_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406266_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406269_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406270_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406271_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406272_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406273_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIIDRCKQF
KP406274_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406275_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406276_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406277_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406278_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406279_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406280_Pol_P-B      INVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLQEDIVDRCKQF
KP406281_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406282_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406283_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406285_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406286_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406287_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406288_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406289_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406290_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406291_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KP406293_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406296_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406297_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406298_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406299_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLKEDIVDRCKQF
KP406300_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406301_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406302_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406303_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406304_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406305_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLTEDIVDRCEQF
KP406306_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLTEDIVDRCEQF
KP406307_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406311_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLKEDIVDRCKQF
KP406319_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406320_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406322_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406325_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406327_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406330_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406331_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP406332_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KP659219_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCTQF
KP659220_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQENIIDRCTQF
KP659223_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPIFNSEWQTPSFPNIHLQENIIDRCEQF
KP659224_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
KP659234_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCKQF
KP659235_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCKQF
KP659237_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCKQF
KP659239_Pol_P-B      PNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KP659240_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KP659244_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCTQF
KP659245_Pol_P-B      PNVDIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPSIHLQENIIDRCEQF
KP659246_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCKQF
KP659247_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCKQF
KP659248_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPAFPNIHLQEDIIDRCQQF
KP659249_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KP659250_Pol_P-B      PNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPNIHLQENIINRCEQF
KP659251_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCXQF
KP659252_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIIDRCKQF
KP659253_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KP659254_Pol_P-B      PNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQENIINRCEQF
KR152339_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KR232337_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KT749820_Pol_P-B      LNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCEQF
KU234318_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPNFNPDWQTPSFPDIHLQEDIVDRCKQF
KU963799_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLREDIVDRCKQF
KU963814_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963815_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963816_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963828_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963829_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963834_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963835_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963841_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963842_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963843_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963853_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963854_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963945_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963948_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963949_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963951_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963953_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963957_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963958_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963960_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963962_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963964_Pol_P-B      LNVSIPWTHKVGNFTGIYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963965_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963967_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963968_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963970_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963971_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963974_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963976_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963980_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963981_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU963987_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964079_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964080_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964083_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964084_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964088_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964090_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964093_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964094_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964095_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964096_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KU964097_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964098_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964101_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964102_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KU964103_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964104_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KU964105_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KU964106_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964108_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964110_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964111_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964112_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964114_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964115_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPNIHLQEDIVDRCKQF
KU964116_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964119_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964121_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964122_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTAPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964123_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964124_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964126_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964130_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964131_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964135_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964136_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964137_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964138_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964139_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964140_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964141_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964143_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964146_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964149_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964150_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964152_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQF
KU964153_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964154_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964155_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964156_Pol_P-B      LNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQF
KU964157_Pol_P-B      LNVSIP