HBVdb

Dataset for protein HBx of genotype B

[Download (right click)] [Sequences] [Repertoires]

2733 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


JX504531_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875426_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU522067_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB010289_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB010290_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010292_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHG
AB031266_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
AB031267_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
AB033554_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB033555_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHG
AB048705_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDG
AB073821_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHG
AB073822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
AB073823_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB073824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
AB073826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073827_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHG
AB073828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073829_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
AB073831_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHG
AB073832_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHG
AB073833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB073836_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073837_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073838_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073839_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073842_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHG
AB073843_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB073844_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHG
AB073845_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHG
AB073846_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHG
AB073847_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073848_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB073849_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AB073850_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073851_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
AB073852_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDG
AB073854_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073855_HBx_P-B      MAARMCCQLDTARDVLCLRPVGAESCGRPLSGPLGALPPASPSAVPTDHG
AB073856_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
AB073857_HBx_P-B      MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073858_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB100695_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHG
AB104890_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB104891_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB106884_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHG
AB115551_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB117759_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB195933_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB205119_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205120_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205121_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB205122_HBx_P-B      MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB212625_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
AB212626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB219426_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219427_HBx_P-B      MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHG
AB219428_HBx_C-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
AB219429_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219430_HBx_P-B      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
AB231909_HBx_P-B      MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
AB241116_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB246339_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AB246340_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB246341_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB246342_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
AB246343_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHG
AB287314_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287316_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287317_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287319_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287320_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHG
AB287321_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
AB287322_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287323_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287325_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287326_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287327_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB300364_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB300370_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHG
AB302095_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB302942_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302945_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHG
AB362933_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB365445_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB368295_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHG
AB471854_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB493827_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHG
AB493835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB555498_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB555499_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB642093_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
AB642094_HBx_P-B      MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
AB642101_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB675676_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHG
AB713527_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB713528_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
AB713529_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713530_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713531_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB828708_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB900095_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900097_HBx_P-B      MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900098_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900102_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB900103_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900104_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB900105_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900106_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHG
AB900107_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900108_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB900110_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900111_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900112_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB931168_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AF100308_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHG
AF100309_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHG
AF121243_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121244_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121246_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
AF121247_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHG
AF121248_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121249_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121250_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121251_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF282917_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHG
AF282918_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AF461360_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF479684_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHG
AJ627225_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
AP011084_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHG
AP011086_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AP011087_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
AP011088_HBx_P-B      MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011089_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHG
AP011090_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011092_HBx_P-B      MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011093_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHG
AP011094_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AP011095_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AP011096_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY033072_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY163869_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY167089_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167093_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNG
AY167094_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY167098_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167100_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY167101_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167102_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHG
AY206373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AY206375_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206383_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY206387_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
AY206390_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
AY206391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217355_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHG
AY217356_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AY217357_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217359_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217361_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217362_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217364_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHG
AY217368_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AY220697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY283777_HBx_P-B      MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY293309_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
AY310322_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY518556_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596102_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596103_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596106_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596109_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596110_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
AY596111_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AY766463_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
AY800389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AY800391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
D00330_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
D00331_HBx_C-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
D23678_HBx_P-B        MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHG
D23679_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ361535_HBx_P-B      MAARLCCQLDPARDVLCLHPVSAESRGRPLSGPLGALPPTSPSVVPTDHG
DQ377158_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ448621_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448624_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448625_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
DQ448627_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448628_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHG
DQ463787_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463788_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463789_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463790_HBx_P-B      MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463791_HBx_P-B      MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHG
DQ463792_HBx_P-B      MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463793_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463795_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
DQ463796_HBx_P-B      MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463798_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
DQ463799_HBx_P-B      MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463800_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463801_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ904357_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993680_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ993681_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHG
DQ993682_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993683_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
DQ993684_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993685_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHG
DQ993686_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993687_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
DQ993694_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHG
DQ993696_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993699_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993700_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
DQ993701_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
DQ993702_HBx_P-B      MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHG
DQ993703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993704_HBx_P-B      MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993705_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993708_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ993710_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ993711_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHG
DQ995802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
DQ995803_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
DQ995804_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
EF134945_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF134946_HBx_P-B      MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473971_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHG
EF473973_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EF473974_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473975_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473977_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
EF494380_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494381_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
EF494382_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU043344_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU139543_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHG
EU158263_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHG
EU305547_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU305548_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU306699_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306700_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306701_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306708_HBx_P-B      MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306712_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
EU330989_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330992_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330994_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330996_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU350409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439018_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439021_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439023_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU487256_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
EU487257_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522066_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU522072_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522074_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU547563_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564823_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU570069_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLG
EU570071_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLG
EU570075_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU579441_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU589335_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU595031_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660231_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660233_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU796066_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796067_HBx_P-B      MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU796068_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796071_HBx_P-B      IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU881997_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU881998_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU882002_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882003_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882004_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919171_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919172_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919173_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919175_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU939559_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939633_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939634_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939636_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939637_HBx_P-B      MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHG
EU939638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
EU939639_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939660_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
EU939661_HBx_P-B      MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
EU939663_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU939664_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939665_HBx_P-B      MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939666_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHG
EU939669_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
EU939670_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939671_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU939672_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
EU939674_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU939675_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939676_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
EU939677_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHG
EU939679_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023631_HBx_P-B      MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHG
FJ023632_HBx_P-B      MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
FJ023633_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHG
FJ023635_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
FJ023636_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023637_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
FJ023638_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHG
FJ032342_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032344_HBx_P-B      LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032353_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032354_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032358_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ349236_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
FJ386583_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHG
FJ386584_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
FJ386600_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
FJ386608_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386610_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDG
FJ386615_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
FJ386634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386636_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386642_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386648_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHG
FJ386655_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHG
FJ386656_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386658_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386660_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
FJ386668_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386669_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386680_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386681_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386684_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ386688_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ518811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
FJ518812_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562219_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562224_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562234_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
FJ562236_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHG
FJ562240_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562246_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562253_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562257_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHG
FJ562259_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562262_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562289_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHG
FJ562296_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562303_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ562311_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562312_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562322_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
FJ787444_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ787475_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787476_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHG
FJ787477_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899779_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
FJ899785_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899786_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899787_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHG
GQ358136_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ358137_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358138_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHG
GQ358143_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358144_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHG
GQ358145_HBx_P-B      MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHG
GQ358146_HBx_P-B      MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ358148_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ358149_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHG
GQ358150_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
GQ358151_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ377525_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377537_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377542_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
GQ377547_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377550_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377558_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377561_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377566_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHG
GQ377567_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHG
GQ377568_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377569_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
GQ377582_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377587_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377588_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377606_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377610_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377612_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377622_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
GQ377625_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377629_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
GQ377641_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
GQ377643_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377644_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
GQ475340_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855522_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855526_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHG
GQ855529_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ855689_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
GQ924605_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
GQ924606_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
GQ924607_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
GQ924608_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHG
GQ924617_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924621_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
GQ924624_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHG
GQ924625_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
GQ924627_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924628_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPAASPSAVPTDHG
GQ924630_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924631_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924632_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924635_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ924637_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924639_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924640_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924641_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHG
GQ924645_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924647_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHG
GQ924651_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ924653_HBx_P-B      MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924656_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GU434372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
GU434373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU451682_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815548_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815560_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815573_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815574_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815578_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815579_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815581_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815583_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHG
GU815590_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815601_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815602_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815603_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815605_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815610_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815623_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
GU815637_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815643_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
GU815653_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
GU815656_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815669_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
GU815670_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815679_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815680_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815685_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815688_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815692_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
GU815704_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815707_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815721_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815722_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815723_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815724_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHG
GU815726_HBx_P-B      MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815727_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRG
GU815732_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHG
GU815733_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815738_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815747_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815770_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815772_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815780_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815783_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011466_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
HM011467_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
HM011469_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HM011470_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011471_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011473_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHG
HM011474_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHG
HM011475_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
HM011476_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
HM011477_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHG
HM011478_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011480_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011482_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011484_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
HM011487_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
HM011490_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHG
HM011492_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
HM011494_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
HM011496_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
HM011499_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
HM011503_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011504_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
HQ700546_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HQ700548_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHG
HQ700549_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
JF412801_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF436921_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JN406371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN792894_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHG
JN792900_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792901_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
JN827419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027311_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHG
JQ027313_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027315_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHG
JQ027316_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHG
JQ027325_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027329_HBx_P-B      MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027330_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027334_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
JQ040128_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
JQ040138_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHG
JQ040147_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040157_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ040170_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JQ040171_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040173_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
JQ341793_HBx_P-B      MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
JQ341795_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341797_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341798_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
JQ341799_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341800_HBx_P-B      MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341803_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
JQ341804_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341808_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHG
JQ341809_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHG
JQ341811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHG
JQ341812_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHG
JQ341813_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHG
JQ341814_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341815_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
JQ341816_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341817_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341818_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
JQ341821_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JQ341822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHG
JQ341823_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHG
JQ341824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHG
JQ341825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341827_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
JQ341830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
JQ341831_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHG
JQ341833_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHG
JQ341835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
JQ341836_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHG
JQ341838_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341839_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341840_HBx_P-B      MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341842_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ341843_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHG
JQ341845_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341848_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341850_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHG
JQ341853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ429079_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429080_HBx_P-B      MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429081_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
JQ429082_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
JQ707734_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707736_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707737_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707740_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707741_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707744_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHG
JQ707757_HBx_P-B      MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707758_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
JQ707762_HBx_P-B      MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ801471_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ801474_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801506_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHG
JQ801507_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQR
JQ801512_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
JQ801514_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026879_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHG
JX026883_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
JX026886_HBx_P-B      MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX429897_HBx_P-B      MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX429899_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHG
JX429900_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
JX429901_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX429902_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX429908_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504532_HBx_P-B      MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHG
JX504533_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504538_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX507210_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX507213_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507215_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661470_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYG
JX661471_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661473_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHG
JX661475_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX661479_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
JX661480_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
JX661481_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHG
JX661482_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661483_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYG
JX661484_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JX869999_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX870001_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHG
JX978431_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC163805_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163809_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHG
KC163810_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163813_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KC163814_HBx_P-B      MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163815_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163829_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC492739_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510641_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510642_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510643_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510644_HBx_P-B      MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC510646_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510648_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510651_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510652_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510653_HBx_P-B      MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC510654_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510656_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510657_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHG
KC510659_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510660_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774362_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPG
KC774363_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774365_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774366_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
KC774367_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KC774368_HBx_P-B      MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHG
KC774369_HBx_P-B      MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHG
KC774370_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHG
KC774372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPG
KC774373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774375_HBx_P-B      MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHG
KC774376_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHG
KC774378_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774379_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC774380_HBx_P-B      MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
KC774381_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KC774382_HBx_P-B      MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774383_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774386_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHG
KC774387_HBx_P-B      MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KC774390_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774393_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHG
KC774395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774396_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774398_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774399_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774400_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774402_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHG
KC774404_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
KC774405_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHG
KC774406_HBx_P-B      MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHG
KC774407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774411_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC774412_HBx_P-B      MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774415_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHG
KC774416_HBx_P-B      MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KC774417_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774418_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHG
KC774419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC814873_HBx_P-B      MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHG
KC814875_HBx_P-B      FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
KC814883_HBx_P-B      MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHG
KC814890_HBx_P-B      KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814917_HBx_P-B      KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814918_HBx_P-B      MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173297_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173298_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173339_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KJ173341_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173343_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173347_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173351_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYG
KJ173352_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173353_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYG
KJ173357_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHG
KJ173359_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173360_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173361_HBx_P-B      MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173362_HBx_P-B      MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173363_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173369_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173375_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173376_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173379_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173380_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173383_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173384_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173386_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173387_HBx_P-B      MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173388_HBx_P-B      MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173401_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
KJ173409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173411_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173416_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173420_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ173422_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ410490_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ410500_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ410502_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ410507_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ790200_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803752_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803756_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803758_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803763_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803764_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KJ803768_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803773_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803775_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803781_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803783_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803784_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803786_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ803789_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803795_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803796_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803801_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803805_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803816_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
KJ803817_HBx_P-B      MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803820_HBx_P-B      MAARLCCQLDTARNVLCLRPVGAESRGRPLPGSLGALPPASPPAVPTDHG
KJ803824_HBx_P-B      MAARLCCQLDPSRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPASPHLVPTDHG
KJ843165_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213032_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KM213036_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM359440_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KM392072_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875416_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KM875418_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875420_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875427_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KP148314_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148317_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148318_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148324_HBx_P-B      MAARLCCQLGPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148326_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148327_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148329_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALSPASPPVVPTDHG
KP148330_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148335_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148336_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148338_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148339_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148342_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDYG
KP148343_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADYG
KP148344_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDYG
KP148345_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148356_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148361_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148362_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148363_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148367_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAGSRGRPLPGPLGALPPASPSAVPTDHG
KP148368_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148369_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KP148371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148372_HBx_P-B      LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148379_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
KP148383_HBx_P-B      MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148394_HBx_P-B      MAARLCCQLDPARYVLCLRPVGAESRGQPLPGPLGALPPASPSAVPTDHG
KP148405_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148406_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KP148410_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148411_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148414_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDRG
KP148415_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148418_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPPPGPLGALPPASPSAVPTDHG
KP148419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP148420_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148423_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148426_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148430_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148439_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148440_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148452_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148453_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148455_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148457_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPHGALPPASPSAVPTDHG
KP148458_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148459_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148461_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPSSPSAVPTDHG
KP148579_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148583_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP659219_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659220_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP659223_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659224_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659234_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659235_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659245_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659246_HBx_P-B      MAARXCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659248_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659249_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALPPXSPSAVPTDHG
KP659250_HBx_P-B      MAARLCCQLDPARDFLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
KP659251_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659252_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
KP659253_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
KP659254_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659255_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVXTDHG
KR152339_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KR232337_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPTASPPVVPADHG
KR811974_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KR811976_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811977_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812005_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812006_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812008_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
KR812009_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812011_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812015_HBx_P-B      MAARPCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812017_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
KR812029_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812035_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812038_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812039_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749820_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU234318_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
KU679959_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU963816_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KU963824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963945_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963948_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963952_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963958_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963962_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963967_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963970_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963971_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963989_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964085_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964093_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964114_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964115_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964125_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964137_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964138_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964153_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964249_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964257_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964264_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964272_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964283_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964284_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964287_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964301_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964381_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276770_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KX276771_HBx_P-B      MAARLCCQLDPARDVLCLRXVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276772_HBx_P-B      MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KX276773_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276774_HBx_P-B      MAXRLCCQLDPARDVLCLRPVGAESRGRPLXGXLGALPPASPPVVPTDHG
KX276775_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
KX276776_HBx_P-B      MAARLXCQLDXXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276777_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KX276778_HBx_P-B      MAARLCCQLDTTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276779_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276781_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276782_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
KX276783_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KX276784_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KX276785_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276786_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTXHG
KX276787_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276788_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276789_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
KX276790_HBx_P-B      MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTXHG
KX276791_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276792_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276794_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276796_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KX276798_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276799_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276800_HBx_P-B      MAARLXCQLDXARBVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276801_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPGVPTDHG
KX276803_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KX276804_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
KX276805_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276806_HBx_P-B      MAARLCCQLDXARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276807_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KX276809_HBx_P-B      MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276810_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276811_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276812_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KX276813_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276814_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX276817_HBx_P-B      MAARLCCQLDPARBVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276818_HBx_P-B      MAARLCCQLDPARDVLCLRPXXAESRGRPLPGXLGALPPASPPAVPTDHG
KX276819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276820_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276821_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPXSPSXVPTDHG
KX276822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPPAVPTDHG
KX276823_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276827_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPXSPXAVPTDHG
KX276829_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPASPSAVPTDHG
KX276830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVSTDHG
KX276858_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPXVPADHG
KX429620_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPSAVPTDHG
KX429622_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX429623_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPTDHG
KX429628_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX429630_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429631_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429648_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429651_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
KX765841_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX765856_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPGIPTDHG
KY417926_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPSNHG
KY470830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470834_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470838_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470953_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470956_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470960_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY629635_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KY629636_HBx_P-B      MAARLCCQLDPARDVLCLRPVGVESRRRPLPGPLGALPTASPSAVPTNHG
KY881721_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881780_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881781_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881782_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881784_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881785_HBx_P-B      MPARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881793_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881795_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881797_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881800_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881820_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881821_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAECSEGHSTGTLRALPPASPSVVQTEHG
KY881822_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881823_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881825_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881826_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881828_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPPVPTDHG
KY881829_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881830_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881831_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881833_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881835_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPLVPTDHG
KY881836_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881837_HBx_P-B      MTARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881838_HBx_P-B      MAARLYCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLVPTDHG
KY881839_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KY881843_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881844_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881845_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KY881853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPVSPPVVPTDHG
KY881856_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881860_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881862_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KY881863_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881864_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881865_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881866_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881899_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881902_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881944_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881945_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881946_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPSAVPTDHG
KY881953_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KY881955_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279268_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349868_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPADHG
LC349869_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349870_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC349871_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPASPSAVQTDHG
LC349872_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTNHG
LC349874_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349879_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
LC416037_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
LC461174_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
LC461175_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC603638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC677084_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPTSPPGVPTDHG
M54923_HBx_P-B        MAARLCCQLDPARDVLCLRSVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059418_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPPASPPVVPTDHG
MF059466_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059495_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059523_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059554_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF059620_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
MF059694_HBx_P-B      MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059706_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059719_HBx_P-B      IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059733_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059737_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF621878_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674382_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674383_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
MF674389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPFVPTDHG
MF674392_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAAPPSAVPPDHG
MF674393_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPAPPSAVPTDHG
MF674394_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVSTDHG
MF674395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPLSAVPTDHG
MF674396_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674400_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674401_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674406_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVPTDHG
MF674407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674410_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674413_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSAVPTDHG
MF674415_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPAPPSAVPTDHG
MF674416_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674420_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674422_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674424_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674427_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVLPTDHG
MF674432_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674433_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPAPPSPVPTDHG
MF674434_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674436_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPATPSAVPTDHG
MF674437_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674439_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674440_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674441_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MF674443_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674445_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674446_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674448_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLRALPPAPPSAVPTDHG
MF674449_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MF674451_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674452_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674453_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
MF674456_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674459_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674460_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674462_HBx_P-B      MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPALPSAVPTDHG
MF674464_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674465_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPAVPTDHG
MF674469_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPEPPSAVPTDHG
MF674470_HBx_P-B      MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPADHG
MF674473_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPVPTDHG
MF674476_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674478_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674479_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674480_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674481_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPASPSAVPTDHG
MF674482_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674485_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
MF674487_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674488_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674491_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674492_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPAPPSAVSSDHG
MF674495_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674500_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRRRSLPGPLGALPPAPPSAVPTDHG
MF674507_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674508_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPAPPSAVPANHG
MF674509_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSTVPTDHG
MF674511_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674512_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674515_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
MG372436_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571321_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
MG571322_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571323_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571324_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571325_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571326_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571327_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571331_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571333_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571334_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571338_HBx_P-B      MAARLCCQLDPARDVLCLRPVDDESRGRPLPGPLGALPPASPPVVPTDHG
MG571339_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGALPPASPPVVPTDHG
MG571340_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPIVPADHG
MG571341_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPLVPTDHG
MG571344_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
MG571346_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571347_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571348_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MG571350_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MG571351_HBx_P-B      MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MG571352_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571353_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571354_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571355_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571356_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
MG571357_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPRLPTDHG
MG571360_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571361_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571364_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPTSPPVVPTDHG
MG571365_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTNHG
MG571367_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571368_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPASPPVVPTDHG
MG571369_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPIVPTDHG
MG571370_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571371_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
MG571373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571376_HBx_P-B      MAARLYCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
MG826152_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
MG826153_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MH488811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPIVPTDHG
MH488812_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488813_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488814_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488816_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488817_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPVVPTDHG
MH488818_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAVHG
MH488819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488820_HBx_P-B      MAAWLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPTSPPAVPTDHG
MH488826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488832_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MH488833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
MH488834_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVIPTVNG
MH488835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHE
MH488836_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MH488840_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488841_HBx_P-B      MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488842_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MH488843_HBx_P-B      MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVSTDHG
MH488845_HBx_P-B      MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
MH488846_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488848_HBx_P-B      MAAGLCCQLDPARNVLCLRPVGAESRGRPLPGSLGALPPATPPGVPTDHG
MH488851_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488855_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH663473_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
MH932712_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPSAVPTDHG
MK052965_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPPVVPTDYG
MK171272_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171280_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPLVPTDHG
MK171284_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171285_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171290_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPLLPTBHG
MK171292_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171304_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHPVPTDHG
MK171306_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVLPTDHG
MK171321_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171331_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171334_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171343_HBx_P-B      MAARLCCQLDPARDVLCLRPVGPESRGRPLPGPLGALPPASPPVVPTDHG
MK171364_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171365_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171366_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDYG
MK171371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171376_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTSSPPVVPTDHG
MK171383_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171396_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGQPLPGPLGALPPASPPVVPTDHG
MK171403_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
MK171409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
MK171413_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171418_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171420_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171421_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171427_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTIHG
MK171460_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
MK171466_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK171467_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVLPTDHG
MK171468_HBx_P-B      MAARLCCQLDPARDVLCLRPVGXESRGRPLPGPLGAVPPASPPVVPTIHG
MK171475_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171476_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171495_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171498_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSVVPTDHG
MK171501_HBx_P-B      MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171507_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171515_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171525_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPHVPTDHG
MK171528_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAAPPVVPTDHG
MK171536_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171542_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171545_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171555_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171579_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGVLPPASPPSLPTDHG
MK171589_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171592_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171599_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171603_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK171606_HBx_P-B      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
MK171632_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPPDHG
MK171638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171643_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171644_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
MK171649_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
MK534554_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534570_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534572_HBx_P-B      MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLGALPPAAPPVLPTDHG
MK534575_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534576_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPPASPSAVPTDHG
MK534591_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534602_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534603_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534608_HBx_P-B      MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534611_HBx_P-B      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
MK534614_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK534621_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK534627_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPADHG
MK534629_HBx_P-B      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSPAVPADHG
MK534658_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534659_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534661_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK534673_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534676_HBx_P-B      MAARLRCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534680_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLRALPPASPSAVPTDHG
MK534691_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MK534693_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534694_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPLVPTDHG
MK534696_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPTDHG
MK534698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSVLPTDHG
MK534699_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK534710_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534727_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK818223_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066375_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN689117_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689118_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689119_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689120_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
MN689121_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPPGALPPASLSAVPTDHG
MN689122_HBx_P-B      MAARLCCQLDPARDVLCLRPVEAESRGRPVSGPFGTLPSPSSSAVPADHG
MN689123_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
MN733920_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
MN733921_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MN733922_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MT111595_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPVVPTDHG
MT426101_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT426102_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
MT426103_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
MT426104_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
MT622522_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPRVPTDHG
MT645001_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT645005_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
MT645016_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MT645018_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT645025_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645041_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MT757436_HBx_P-B      MAARLCCQLDPARDVLCFRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757437_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757438_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757440_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757442_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757450_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757455_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSVVPTDHG
MW310261_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW310264_HBx_P-B      MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW497299_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MW845288_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAXPXAVPTDHG
MW845289_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845290_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
MW845291_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845292_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MW845293_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845295_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845296_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTVYG
MW845297_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHLVPTDHG
MW845298_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
MW845300_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
MW845301_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
MW845302_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MW845303_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MW845304_HBx_P-B      MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
MW845307_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845308_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845309_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLGVPTDHG
MW845310_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845311_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MW845312_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPLPTDHG
MZ439517_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439518_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439521_HBx_P-B      MAARLGCQLDTARDVLCLRPVGAESRGRPLPGPHGAVQPASPPAVPTDHG
MZ439523_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ671236_HBx_P-B      MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MZ671237_HBx_P-B      MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
MZ675785_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
MZ675786_HBx_P-B      MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
MZ675794_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ675795_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MZ675798_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675805_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ934423_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ934427_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAHPPVVPTDHG
MZ934428_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ934429_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
MZ934430_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
MZ934437_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934438_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
ON402775_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
ON402778_HBx_P-B      MAARVCCQLDPARDILCLRPVGAESRGRPLPGPLGALSPGSPPVVPTDHG
ON402781_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
X97850_HBx_P-B        MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPAVPTDHG
D00329_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
KX276828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB010291_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
JX504543_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073834_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073840_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448619_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924610_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815549_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815550_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815551_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815552_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815553_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815554_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815555_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815556_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815557_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815558_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815559_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815561_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815562_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815563_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815564_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815565_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815566_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815567_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815568_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815569_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815570_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815571_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815575_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815576_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815616_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815618_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815625_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815627_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815629_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815630_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815631_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815632_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815635_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815639_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815641_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815642_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815644_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815645_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341794_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341810_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341837_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX869998_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173424_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173425_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276815_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674450_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571337_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571342_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT426100_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OM688314_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571366_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073841_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB287329_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167097_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448623_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924603_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924611_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815617_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815619_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815620_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815621_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815622_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815624_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815628_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815633_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815636_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040125_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341796_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341807_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801479_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661478_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC315393_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963842_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963843_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963844_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963845_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963846_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963847_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963848_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963849_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963850_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963851_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963852_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276793_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276808_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX429647_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH061283_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674387_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674423_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674461_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AP011085_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50521_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50522_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803755_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803787_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429621_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349875_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674384_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674496_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534709_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MW847941_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674404_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674405_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674414_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674455_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674499_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW845286_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB195934_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195935_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ448620_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB241117_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB287328_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
EU043342_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562321_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845306_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB287315_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287318_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659237_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659247_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EU306677_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306678_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306679_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306680_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306681_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB302943_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302944_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB471855_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK534601_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB931169_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AF121245_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
X97851_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AP011091_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473976_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358140_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358141_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473972_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MG571336_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY033073_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY163870_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
KC774388_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596104_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY596105_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP036970_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059711_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220704_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448622_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993709_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043343_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939667_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386654_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386683_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU357842_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774410_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803808_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148580_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148581_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148582_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059425_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059511_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059735_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171448_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171546_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534571_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534711_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OK106254_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939673_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386682_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562231_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774394_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213034_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534705_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534708_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217358_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217360_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032357_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MK171478_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
OM688316_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
DQ448626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ975271_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386666_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815672_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF899335_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173368_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173381_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173382_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173413_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173414_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173415_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964244_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964245_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964246_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964247_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964248_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964250_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964251_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964252_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964253_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964254_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964255_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964256_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059357_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059358_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059359_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059360_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059361_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059362_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059363_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059364_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059365_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059366_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059367_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059368_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059369_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059370_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059375_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059376_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059378_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059379_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059380_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059381_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059382_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059383_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059384_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059386_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059387_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059388_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059390_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059392_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059393_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059394_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059396_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059398_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059399_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059400_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059401_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059402_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059403_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059404_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059405_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059406_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059408_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059410_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059411_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059412_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059413_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059414_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059415_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059416_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059417_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059419_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059420_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059421_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059422_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059423_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059424_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059426_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059427_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059428_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059429_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059430_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059431_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059432_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059433_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059434_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059435_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059436_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059437_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059438_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059439_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059440_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059441_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059442_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059443_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059444_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059445_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059446_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059447_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059448_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059449_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059450_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059452_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059453_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059454_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059455_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059456_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059457_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059458_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059459_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059460_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059461_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059462_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059463_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059464_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059465_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059467_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059468_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059469_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059470_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059471_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059472_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059473_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059476_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059477_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059478_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059479_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059480_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059481_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059482_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059483_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059484_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059485_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059486_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059487_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059488_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059489_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059490_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059491_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059492_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059493_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059494_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059496_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059497_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059498_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059499_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059500_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059501_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059502_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059503_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059504_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059505_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059506_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059507_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059508_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059509_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059510_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059512_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059513_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059514_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059515_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059516_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059517_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059518_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059519_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059520_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059521_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059522_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059524_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059525_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059526_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059527_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059528_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059529_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059530_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059531_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059532_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059533_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059534_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059535_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059536_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059537_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059538_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059539_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059540_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059541_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059542_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059543_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059544_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059545_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059546_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059547_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059548_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059549_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059550_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059551_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059552_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059553_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059555_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059556_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059557_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059558_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059559_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059560_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059561_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059562_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059564_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059565_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059566_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059567_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059568_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059569_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059570_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059571_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059572_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059573_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059575_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059576_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059577_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059578_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059579_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059580_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059581_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059582_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059583_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059584_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059585_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059586_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059587_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059588_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059589_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059590_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059591_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059592_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059593_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059594_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059595_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059596_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059597_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059598_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059599_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059600_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059601_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059602_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059603_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059604_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059605_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059606_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059607_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059608_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059610_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059611_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059612_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059613_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059614_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059615_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059616_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059617_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059618_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059619_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059621_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059622_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059623_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059624_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059625_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059627_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059628_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059629_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059630_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059631_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059632_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059633_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059635_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059636_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059637_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059638_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059639_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059640_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059641_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059642_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059643_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059644_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059645_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059646_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059647_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059648_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059649_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059650_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059651_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059653_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059654_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059655_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059656_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059657_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059658_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059659_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059660_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059661_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059662_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059663_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059664_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059665_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059666_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059667_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059668_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059669_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059670_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059671_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059672_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059673_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059675_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059676_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059677_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059678_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059679_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059680_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059681_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059682_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059683_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059684_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059685_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059686_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059687_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059689_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059690_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059691_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059692_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059693_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059695_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059696_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059699_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059701_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059702_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059704_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059705_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059707_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059708_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059709_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059710_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059712_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059713_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059714_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059715_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059716_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059717_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059718_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059720_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059721_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059722_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059723_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059724_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059726_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059727_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059728_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059729_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059730_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059731_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059732_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059734_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059736_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059738_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059739_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571358_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171273_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW310262_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596112_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
AY800392_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
EU306695_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306696_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ463794_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463797_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
JN792895_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
JN792896_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
JN792899_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
JN792897_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792898_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792893_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
EU939678_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032349_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386675_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562222_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341844_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213035_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993706_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993707_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815711_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815712_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815713_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815715_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815716_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815717_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815718_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815719_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815720_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674503_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674506_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MK171486_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU439020_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439022_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386582_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562237_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815646_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815647_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815648_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815649_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815650_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815651_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815652_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815654_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815657_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815658_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815659_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815660_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815661_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815662_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815663_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815664_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815665_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815666_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815667_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815668_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815673_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815674_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815675_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815676_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815677_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815678_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ688405_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661476_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774401_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774409_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173367_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173399_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173400_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173407_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173408_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963799_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963800_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963801_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963802_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963803_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963804_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963805_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963806_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963807_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963808_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963809_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963810_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963812_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963813_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964123_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964124_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964126_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964127_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964128_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964129_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964130_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964131_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964132_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964133_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964134_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964135_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964136_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171482_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW310263_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OM688315_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
LC349877_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KT749853_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276797_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171369_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043345_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306702_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306704_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306705_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306706_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306707_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306709_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306710_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306711_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU330990_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330995_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330997_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK534702_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330998_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330999_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331000_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331001_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU660224_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
EU522073_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522075_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX429910_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171283_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171424_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534707_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU919176_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ562260_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881849_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534599_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
X98077_HBx_P-B        MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899784_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899790_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ899791_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MW847940_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
FJ386676_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ562254_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774408_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171497_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171516_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC774384_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MK171558_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562316_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011483_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661472_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661474_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC774371_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ358147_HBx_P-B      MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ358152_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK171490_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX429616_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429624_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429627_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349873_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534634_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674421_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
GQ924646_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924648_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
HM153811_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801494_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801516_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173405_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173406_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924654_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
KJ173403_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173404_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963976_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963977_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963978_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963979_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963981_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963982_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963983_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963984_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963985_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963986_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815640_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815577_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815584_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815585_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815586_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815587_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815588_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815589_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815591_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815593_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815594_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815595_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815596_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815597_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815598_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815599_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815600_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815604_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815606_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815607_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815608_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815609_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815611_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815612_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815613_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815614_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
JQ801524_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815681_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815683_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815684_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815686_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815687_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815689_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815691_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815693_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815695_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815696_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815697_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815698_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815699_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815700_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815701_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815702_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815703_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815705_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815706_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815708_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815709_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815710_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815729_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815725_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815728_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815730_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815731_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815734_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815735_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815736_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815737_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815739_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815740_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815741_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815742_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815743_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815744_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815745_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815746_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815748_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815749_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815750_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815751_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815752_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815753_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815754_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815755_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815756_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815757_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815759_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815760_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815761_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815762_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815764_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815765_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815766_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815767_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815768_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815769_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815771_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815773_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815774_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815775_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815776_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815777_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815778_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815779_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815781_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815782_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN792902_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
JQ027331_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX765854_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
JQ707735_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707748_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707751_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707752_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707754_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707756_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707760_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707761_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707738_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707739_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707742_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707743_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707747_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707749_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707750_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707755_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707759_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707763_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707764_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707765_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707767_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707745_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707746_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707753_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707766_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
MK534692_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
MK534732_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774403_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963960_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963961_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963964_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963965_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963966_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963968_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963969_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963972_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963973_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963974_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963975_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964079_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964080_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964081_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964082_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964084_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964086_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964087_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964089_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964090_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964091_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964108_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964109_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964110_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964111_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964113_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964116_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964118_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964119_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964120_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964121_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964122_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171380_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC163812_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163816_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163817_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163818_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163820_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163821_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163823_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163824_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163827_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163828_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963980_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963987_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963988_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163831_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510649_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510658_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510647_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510650_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510655_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC774413_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774392_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM392083_HBx_P-B      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173365_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173366_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MF674426_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571328_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171598_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470954_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470962_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KJ173340_HBx_P-B      MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KJ173342_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173356_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173345_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173348_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173354_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173355_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173364_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
MK171523_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173370_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK075117_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK171374_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534573_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534578_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534581_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534600_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KU963814_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963815_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963817_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963818_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963819_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963820_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963821_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963822_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963823_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963825_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963826_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963827_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963854_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MG571349_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171499_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173378_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173390_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173398_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173402_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
KJ173410_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
MF059609_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173412_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173417_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173421_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ173423_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ410516_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410517_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ803797_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
LC349878_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MW845299_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK171601_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875417_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KP148319_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148320_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148321_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148322_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148323_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148325_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148328_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148331_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148332_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148334_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148365_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148333_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148357_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148359_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148364_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148366_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148340_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148341_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148346_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148347_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148348_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148349_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052962_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052964_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK171372_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148360_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148370_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148373_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148375_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148376_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148377_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148378_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148380_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148382_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148384_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148386_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148387_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148388_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148389_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148390_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148392_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148396_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148398_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148399_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148400_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148401_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148402_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148403_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148437_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148451_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KP148425_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MW887648_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148413_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148424_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148435_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148438_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148416_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148421_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148429_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148433_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148427_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP148456_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148460_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KR812026_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812028_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812031_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812036_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811979_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674483_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
KU963829_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963830_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963831_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963832_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963834_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963836_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963837_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963838_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963839_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963840_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963841_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963855_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963946_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963947_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963949_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963950_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963951_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963953_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963954_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963956_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963957_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963959_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963955_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963963_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU964088_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964092_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964083_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964112_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171605_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534683_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964094_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964095_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964096_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964097_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964098_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964099_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964100_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964101_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964102_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964103_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964104_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964105_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964106_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964107_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964117_HBx_P-B      MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964139_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964140_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964141_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964142_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964143_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964144_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964145_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964146_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964147_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964148_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964149_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964150_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964151_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964152_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964154_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964155_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964156_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964157_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964158_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964159_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964160_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964161_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964162_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964163_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964164_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964165_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964166_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964167_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964168_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964394_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964258_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964259_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964260_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964261_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964262_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964263_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964265_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964266_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964267_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964268_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964269_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964270_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964271_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964273_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964274_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964275_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964276_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964277_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964278_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964279_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964280_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964281_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964282_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964285_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964286_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964288_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964289_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964290_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964291_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964292_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964293_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964294_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964295_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964296_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964297_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964298_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964299_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964300_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964302_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964382_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964383_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964384_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964385_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964388_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964391_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964393_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964395_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674397_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MF674438_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MZ675796_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675797_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675799_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY470832_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470833_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470835_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470836_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470839_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470840_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470837_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470841_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470961_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY881722_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881723_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881724_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881725_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881726_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881727_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881728_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881729_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881730_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881731_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881732_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881733_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881734_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881735_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881740_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881741_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881745_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881746_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881747_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881752_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881753_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881756_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881757_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881759_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881760_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881761_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881778_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881779_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881869_HBx_P-B      MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881783_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881786_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881787_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881788_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881789_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881790_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881791_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881794_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881796_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881798_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881799_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881801_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881808_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881850_HBx_P-B      MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881824_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881827_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881834_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881841_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881842_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881846_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881847_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881848_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881851_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881852_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881854_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881855_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881857_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881858_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881859_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881861_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881867_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881868_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881893_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881894_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881895_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881896_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881897_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881898_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881900_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881901_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881903_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881904_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881905_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881906_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881907_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881908_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881909_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881910_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881911_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881912_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881913_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881914_HBx_P-B      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881948_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881949_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881950_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881951_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881952_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881957_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881958_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881947_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881954_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881956_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279269_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279270_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279271_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279272_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279273_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059700_HBx_P-B      MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674447_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674498_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674505_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674466_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MW845305_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674477_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674493_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MZ671238_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MZ671239_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MF674510_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674513_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674490_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674497_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MG571329_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571362_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MH488856_HBx_P-B      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MK171587_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171613_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171552_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK534626_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534612_HBx_P-B      MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MT645057_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MT645058_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK534733_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534704_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSVLPTDHG
MT757439_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757448_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757451_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757453_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757457_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757443_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757444_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757445_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757446_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757449_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757452_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757454_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757456_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757441_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757447_HBx_P-B      MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MZ934426_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934435_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934436_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934439_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934440_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ439519_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439520_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439522_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439525_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439526_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439528_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439530_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439531_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439533_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439534_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439535_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439536_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439537_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439540_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439542_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439543_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439545_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439546_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439548_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439551_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439524_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439527_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439529_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439532_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439538_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439539_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439541_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439544_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439547_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439549_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439550_HBx_P-B      MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ675807_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MZ675800_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675801_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675803_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675804_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675806_HBx_P-B      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
                             :    *  : :                    .       .   

JX504531_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRM-VLVNTHWNLPKVLHKRTLGL
KM875426_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
EU522067_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB010289_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB010290_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB010292_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB031266_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
AB031267_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AB033554_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB033555_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB048705_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHMILPKVLHKRTLGL
AB073821_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
AB073822_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073823_HBx_P-B      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073824_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073825_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHNRTLGL
AB073826_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073827_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073828_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073829_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073830_HBx_P-B      AHLSSRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AB073831_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073832_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073833_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073835_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073836_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AB073837_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AB073838_HBx_P-B      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073839_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB073842_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073843_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLXKRTLGL
AB073844_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073845_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073846_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073847_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073848_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073849_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073850_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
AB073851_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073852_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073853_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073854_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073855_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
AB073856_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073857_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB073858_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
AB100695_HBx_P-B      AHLSLRGLPVCAFSCAGPCALRFTSARRMETTVNAHRILSKDLRTMTLEL
AB104890_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNDHRNLSKVLHKRTLGL
AB104891_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNDHRNLSKVLHKRTLGL
AB106884_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARHMETTVNAHQNLPKVLHKRTLGL
AB115551_HBx_P-B      AHHTLRGLPVCLFSAAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB117759_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
AB195933_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB205119_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB205120_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB205121_HBx_P-B      AHLSLPGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB205122_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB212625_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB212626_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKILHKRTLGL
AB219426_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTXNAHRNLPKVLHKRTLGL
AB219427_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB219428_HBx_C-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB219429_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB219430_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB231909_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAHLILPKVLHKRTLGL
AB241116_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB246339_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB246340_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB246341_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSACRMETTVNAHRNLPKVLHKRTLGL
AB246342_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB246343_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB287314_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB287316_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRSLPKVLHKRTLGL
AB287317_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
AB287319_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFISARRMETTVNAHRNLPKVLHKRTLGL
AB287320_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
AB287321_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
AB287322_HBx_P-B      AYLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRSLPKVLHKRTLGL
AB287323_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AB287325_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
AB287326_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB287327_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB300364_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB300370_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB302095_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB302942_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB302945_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB362933_HBx_P-B      AHLSLRALPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB365445_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLHKRTLGL
AB368295_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB471854_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AB493827_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB493833_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB493835_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAHRNLPKVLHKRTLGL
AB555498_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB555499_HBx_P-B      AHLSFRGLPVCAFSSAGPSALRFTSARRMETTVNARQVLPKVLHKRTLGL
AB642093_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB642094_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB642101_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB675676_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB713527_HBx_P-B      AHLSLRGLPVCAFSSAGTCALRFTSARRKENTVNAHRNLPQVLHKRTLGL
AB713528_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB713529_HBx_P-B      AHLSLRGTPVCAFSSAGPCALRFTSARRKETTVNAHWKLPQVLHKRTLGL
AB713530_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRRETTVNAHRNLPKVLHRRTLGL
AB713531_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB828708_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900095_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900097_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
AB900098_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900102_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
AB900103_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
AB900104_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900105_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900106_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900107_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVNAHRNLPKVLHKRTLGL
AB900108_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
AB900110_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900111_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AB900112_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRVETTVNAHRNLPKVLHKRTLGL
AB931168_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AF100308_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AF100309_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AF121243_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
AF121244_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
AF121246_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
AF121247_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLHKRTLGL
AF121248_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AF121249_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AF121250_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AF121251_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AF282917_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKALHKRTLGL
AF282918_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AF461360_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AF479684_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AJ627225_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011084_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011086_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011087_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011088_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011089_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
AP011090_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011092_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011093_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AP011094_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AP011095_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
AP011096_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY033072_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLQERTLGL
AY163869_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY167089_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY167093_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AY167094_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMEATVNAHRNLPKVLHKRTLGL
AY167098_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AY167100_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AY167101_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY167102_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALRNLPKVLHKRTLGL
AY206373_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHVNLPKVLHKRTLGL
AY206375_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY206383_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AY206387_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY206390_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
AY206391_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY217355_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY217356_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY217357_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AY217359_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY217361_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY217362_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLSKVLHKRTLGL
AY217364_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTIGL
AY217368_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY220697_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
AY283777_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY293309_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY310322_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY518556_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY596102_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY596103_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
AY596106_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY596109_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY596110_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY596111_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AY766463_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
AY800389_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
AY800391_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
D00330_HBx_P-B        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
D00331_HBx_C-B        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
D23678_HBx_P-B        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
D23679_HBx_P-B        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNGHRNLPKVLHKRTLGL
DQ361535_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWTLPKVLHKRTIGL
DQ377158_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ448621_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ448624_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
DQ448625_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ448627_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
DQ448628_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463787_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463788_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463789_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463790_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463791_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463792_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463793_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463795_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463796_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463798_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463799_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ463800_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463801_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
DQ463802_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ904357_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
DQ993680_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
DQ993681_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
DQ993682_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLXKVLHKRTLGL
DQ993683_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNXHWNLPKVLHKRTLGL
DQ993684_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
DQ993685_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
DQ993686_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
DQ993687_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ993694_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ993696_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ993697_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKXTLGL
DQ993698_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
DQ993699_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
DQ993700_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ993701_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
DQ993702_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
DQ993703_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLQERTLGL
DQ993704_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLQERTLGL
DQ993705_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLQERTLGL
DQ993708_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
DQ993710_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
DQ993711_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMEATVNAHRNLPKVLHKRTLGL
DQ995802_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
DQ995803_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
DQ995804_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF134945_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF134946_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF473971_HBx_P-B      AHLSLRGLPGCAFSSAGPGALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF473973_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF473974_HBx_P-B      AHLSLRGLPVCAFSSAGPSALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF473975_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF473977_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF494380_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EF494381_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKALHKRTLGL
EF494382_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRTLPKVLHERTIGL
EU043344_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU139543_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU158263_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
EU305547_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVSHKRTLGL
EU305548_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLRKRTLGL
EU306699_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVWHKRTLGL
EU306700_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
EU306701_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
EU306708_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
EU306712_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
EU330989_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
EU330992_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTTGL
EU330994_HBx_P-B      AHLSLRGLPVCASSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
EU330996_HBx_P-B      AHLSLRGLPVCAFSSAGPCTLRFTSARRMETTVNAHRTLPKVLHKRTIGL
EU350409_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
EU439018_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRAPGL
EU439021_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAHWNLPKVLHKRTLGL
EU439023_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU487256_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU487257_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
EU522066_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU522072_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU522074_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRVLPKVLHKRTLGL
EU547563_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
EU564822_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAQGNLPKVLHKRTLGL
EU564823_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAQGNLPKVLHKRTLGL
EU564826_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU570069_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNVHGNLPKVLHKRTLGL
EU570071_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNVHGNLPKVLHKRTLGL
EU570075_HBx_P-B      AHPSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU579441_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU589335_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU595031_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLRKRTLGL
EU660231_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU660233_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU796066_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU796067_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU796068_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU796071_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU881997_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU881998_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU882002_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU882003_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU882004_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU919171_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU919172_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU919173_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU919175_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDPWNLPKVLHKRTLGL
EU939559_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939633_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU939634_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU939636_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
EU939637_HBx_P-B      AHLSLRGFPVCALSSAGPCALRFPSARRMETTVNAHRNLPKVLHKRTLGL
EU939638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
EU939639_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939660_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939661_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939663_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939664_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939665_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
EU939666_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXRNLPKVLHKRTLGL
EU939669_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLXKRTLGL
EU939670_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939671_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
EU939672_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939674_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
EU939675_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
EU939676_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939677_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
EU939679_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023631_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023632_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023633_HBx_P-B      AHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023634_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023635_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRTLGL
FJ023636_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ023637_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
FJ023638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWTLPKVLHKRTIGL
FJ032342_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVIAHRNLPKVLHQRTLGL
FJ032344_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVIAHRNLPKVLHQRTLGL
FJ032353_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ032354_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ032358_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ349236_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386583_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVKDHRNLPKVLHKRTLGL
FJ386584_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
FJ386600_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
FJ386608_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386610_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386615_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386634_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386636_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386642_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386648_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXXLPKVLHKRTLGL
FJ386655_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386656_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386658_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386660_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
FJ386668_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386669_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386680_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386681_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386684_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ386688_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGSLPKVLHKRTLGL
FJ518811_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ518812_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRSLPKVLHKRTLGL
FJ562219_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562224_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562234_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562236_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562240_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562246_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562253_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562257_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
FJ562259_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
FJ562262_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
FJ562289_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
FJ562296_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562303_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTLNAHRNLPKVLHKRTLGL
FJ562311_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ562312_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
FJ562322_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ787444_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ787475_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ787476_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ787477_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
FJ899779_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ899785_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRSTSARRMETTVNAHRNLPKVLHKRTLGL
FJ899786_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
FJ899787_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358136_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTCARRMETTVNAHRNLPKVLHKRTLGL
GQ358137_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358138_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358143_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358144_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358145_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358146_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358148_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358149_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358150_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ358151_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377525_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
GQ377537_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377542_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377547_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ377550_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377558_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ377561_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
GQ377566_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377567_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
GQ377568_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377569_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377582_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLQKRTLGL
GQ377587_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377588_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377606_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377610_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377612_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ377622_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377625_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ377629_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377641_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
GQ377643_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ377644_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ475340_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ855522_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ855526_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
GQ855529_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GQ855689_HBx_P-B      AHLSLPGLPVCAFSSAGPCALRFTSARRMETTANAHQNLTKALHNRTLGL
GQ924605_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ924606_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ924607_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924608_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ924617_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924621_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924624_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924625_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924626_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924627_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ924628_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924630_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924631_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924632_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GQ924635_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924637_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTLGL
GQ924638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924639_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924640_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924641_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924645_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924647_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924651_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924653_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GQ924656_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHTRTLGL
GU434372_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU434373_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU451682_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
GU815548_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GU815560_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GU815573_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
GU815574_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNTPGNLPKVLHKRTLGL
GU815578_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTPGNLPKVLHKRTLGL
GU815579_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815581_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815583_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815590_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSTRRMETTVNAHRNLPKVLHKRTLGL
GU815601_HBx_P-B      AHLSLRELPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815602_HBx_P-B      AHLPLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815603_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815605_HBx_P-B      AHFSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815610_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815623_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GU815637_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GU815643_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
GU815653_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815656_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815669_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815670_HBx_P-B      AHLSLRGLPVCALSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815679_HBx_P-B      AHLSLRGLPVCAFSSPGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815680_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815685_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815688_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815692_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815704_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815707_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815721_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815722_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815723_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815724_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815726_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815727_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815732_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815733_HBx_P-B      AHLSLRGLPVCAFSTAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
GU815738_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
GU815747_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
GU815770_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAQRNLPRVLHKRTLGL
GU815772_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
GU815780_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
GU815783_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
HM011466_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
HM011467_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011469_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011470_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011471_HBx_P-B      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011473_HBx_P-B      AHLSLRGLPVCAFSSXGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011474_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWTLPKVLHKRTLGL
HM011475_HBx_P-B      AHLSLRGLPXCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
HM011476_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
HM011477_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
HM011478_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNXXGNLPKVLHKRTLGL
HM011480_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXGNLPKVLHKRTLGL
HM011482_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNANWNLPKVLHKRTLGL
HM011484_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQNLPKVLHKRTLGL
HM011487_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011490_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011492_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011494_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
HM011496_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARHMETTVNAHRNLPKVLHKRTLGL
HM011499_HBx_P-B      XHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HM011503_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
HM011504_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
HQ700546_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
HQ700548_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
HQ700549_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JF412801_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JF436921_HBx_P-B      AHLSLRELPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JN406371_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
JN792894_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JN792900_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JN792901_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JN827419_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ027311_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ027313_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
JQ027315_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ027316_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
JQ027325_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
JQ027329_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLYKRTLGL
JQ027330_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
JQ027334_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ040128_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ040138_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXXLPKVLHKRTLGL
JQ040147_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPWNLPKVLHKRTLGL
JQ040157_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ040170_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ040171_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ040173_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341793_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341795_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341797_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
JQ341798_HBx_P-B      AHLSLRGLPVCAFSSAXPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341799_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341800_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341802_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341803_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ341804_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341808_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341809_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341811_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341812_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341813_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
JQ341814_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341815_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
JQ341816_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341817_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341818_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341819_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341821_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGXLPKVLHKRTLGL
JQ341822_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341823_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341824_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
JQ341825_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341827_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341830_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ341831_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ341833_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARHMETTVNAHRNLPKVLHKRTLGL
JQ341835_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARXNLPKVLHKRTLGL
JQ341836_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXGNLPKVLHKRTLGL
JQ341838_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
JQ341839_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341840_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRXETTVNAHRNLPTVLHKRTLGL
JQ341842_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341843_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341845_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ341848_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLXKVLHKRTLGL
JQ341850_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXRNLPKVLHKRTLGL
JQ341853_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ429079_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ429080_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ429081_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ429082_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ707734_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ707736_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
JQ707737_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ707740_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ707741_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
JQ707744_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ707757_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
JQ707758_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ707762_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JQ801471_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JQ801474_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ801506_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNVHRNLPKVLHKRTLGL
JQ801507_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ801512_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JQ801514_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX026879_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX026883_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHERTLGL
JX026886_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX429897_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
JX429899_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX429900_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX429901_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX429902_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX429908_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JX504532_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX504533_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNVHRNLPKVLHKRTLGL
JX504538_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKSTLGL
JX507210_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHENLPKVLHKRTLGL
JX507213_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTXGL
JX507215_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JX661470_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
JX661471_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRTLGL
JX661473_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX661475_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX661479_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNVHGNLPKVLHKRTLGL
JX661480_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JX661481_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX661482_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JX661483_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
JX661484_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAHRNLPKVLHKRTLGL
JX869999_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGTLPKVLHKRTLGL
JX870001_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
JX978431_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163805_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163809_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163810_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163811_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHRNLPKVLHKRTLGL
KC163813_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163814_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC163815_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRILGL
KC163829_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC492739_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARHMETTVNAHRNLPKVLHKRTLGL
KC510641_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
KC510642_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510643_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510644_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNPHRNLPKVLHKRTLGL
KC510646_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510648_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNPHRNLPKVLHKRTLGL
KC510651_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510652_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510653_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510654_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510656_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510657_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510659_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC510660_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774362_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARSMETTVNAHRNLPKVLHKRTLVL
KC774363_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774365_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774366_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774367_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAYRNLPKVLHKRTLGL
KC774368_HBx_P-B      AHLSLRGLPVCAFSFAGPCALCFTFARCKETPVNAHRNLPKVLHKRTLGL
KC774369_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRNFGL
KC774370_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRTLGL
KC774372_HBx_P-B      GPLSLRGLPVCAFSSAGPCALCFPSARRMETPVNAPRNFPKVLQKRIFVL
KC774373_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774374_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774375_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTYARRMETTVNAHGNLPKVLHKRTLGL
KC774376_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774378_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774379_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774380_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774381_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774382_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRNLGL
KC774383_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KC774385_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774386_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774387_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774389_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774390_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774391_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774393_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNSHRNLPKVLHKRTLGL
KC774395_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774396_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774397_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774398_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774399_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774400_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774402_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774404_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774405_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774406_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774407_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774411_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774412_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774415_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC774416_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774417_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774418_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC774419_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KC814873_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KC814875_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KC814883_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRDLPKVLHKRTLGL
KC814890_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KC814917_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KC814918_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ173297_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ173298_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ173339_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173341_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173343_HBx_P-B      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ173347_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173351_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173352_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173353_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173357_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173359_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173360_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARWNLPKVLHKRTLGL
KJ173361_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173362_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173363_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173369_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ173373_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAYRNLPNVLHKRTLGL
KJ173374_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAYRNLPKVLHKRTLGL
KJ173375_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173376_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173377_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173379_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173380_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHNRTLGL
KJ173383_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173384_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173385_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173386_HBx_P-B      AHLSLRGLPVCAFSSAGPSALRLTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173387_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRTLGL
KJ173388_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHRNLPKVLHKRTLGL
KJ173397_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173401_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPAVLHKRTLGL
KJ173409_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173411_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173416_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ173420_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ173422_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ410490_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ410500_HBx_P-B      AHLSLRGLPVCAFSSAGPCALLFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ410502_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHERTLGL
KJ410507_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ790200_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803752_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ803756_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803758_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803763_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803764_HBx_P-B      AHLSLRGLPVCAFSFAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803768_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803773_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHVNLPKVLHKRTLGL
KJ803775_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHVNLPKVLHKRTLGL
KJ803781_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803783_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803784_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803786_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ803789_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ803795_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803796_HBx_P-B      AHLSLRGLPVCVFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803801_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803805_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803816_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
KJ803817_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KJ803819_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDRWNLPKVLHKRTLGL
KJ803820_HBx_P-B      AYLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KJ803824_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KJ803825_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAYRNLPKVLHKRTLGL
KJ843165_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KM213032_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHKNLPKVLHKRTLGL
KM213036_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KM359440_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFPSARRMETTVNAHGNLPKVLHKRTLGL
KM392072_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KM875416_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KM875418_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KM875420_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQNLPKVLHKRTLGL
KM875427_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148314_HBx_P-B      AHLSLRGLPVCAFSSAGLCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148317_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148318_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148324_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148326_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148327_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148329_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARPMETTVNAHGNLPKVLHKRTLGL
KP148330_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148335_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148336_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148338_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148339_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148342_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148343_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148344_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148345_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KP148356_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148361_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148362_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148363_HBx_P-B      ARLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KP148367_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148368_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148369_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148371_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148372_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148374_HBx_P-B      ARLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148379_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148383_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148394_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148405_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148406_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148407_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148409_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148410_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148411_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148414_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148415_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148418_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148419_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148420_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148423_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP148426_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPEVLHKRTLGL
KP148430_HBx_P-B      AHLSLRGLSVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTFGL
KP148439_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFISARRMETTVNTHRNLPKVLHKRTLGL
KP148440_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KP148452_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSTRRMETTVNAHRTLPKVLHKRTIGL
KP148453_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
KP148455_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
KP148457_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
KP148458_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
KP148459_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
KP148461_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGF
KP148579_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAYRNLPKVLHKRTLGL
KP148583_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659219_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659220_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
KP659223_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
KP659224_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659234_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659235_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659245_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQNLPKVLHKRTLGL
KP659246_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659248_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659249_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLXKRTLGL
KP659250_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLXKRTLGL
KP659251_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
KP659252_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659253_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFXSARRMETTVNXHRNLPKVLHKRTLGL
KP659254_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KP659255_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHRNLPKVLHKRTLGL
KR152339_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KR232337_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KR811974_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KR811976_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KR811977_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KR812005_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARWNLPKVLHKRTLGL
KR812006_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KR812008_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHWNLPKVLHKRTLGL
KR812009_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARRNLPKVLHKRTLGL
KR812011_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KR812015_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KR812017_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNARWNLPKVLHKRTLGL
KR812029_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KR812035_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKALYKRTLGL
KR812038_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRSTSARRMETTVNAHGNLPKVLYKRTLGL
KR812039_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KT749820_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHWNLPKVLYKRTLGL
KU234318_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
KU679959_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHMILPKVLHKRTLGL
KU963816_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU963824_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963828_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963945_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU963948_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU963952_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU963958_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU963962_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963967_HBx_P-B      AHLSLRGLPVCAFSSAGPCTLRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963970_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963971_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU963989_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964085_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964093_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964114_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964115_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964125_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964137_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964138_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KU964153_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KU964249_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLHKRTLGL
KU964257_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KU964264_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
KU964272_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHRNLPKVLHKRTLGL
KU964283_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHRNLPKVLHKRTLGL
KU964284_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHRNLPKVLHKRTLGL
KU964287_HBx_P-B      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964301_HBx_P-B      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KU964381_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276770_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276771_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276772_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276773_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276774_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276775_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276776_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276777_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX276778_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276779_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXGNLPKVLHKRTLGL
KX276781_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276782_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276783_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTXNAXWNLPKVLHKRTLGL
KX276784_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
KX276785_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
KX276786_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNXHRNLPKVLHKRTLGL
KX276787_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KX276788_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNPHGNLPKVLHKRTLGL
KX276789_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
KX276790_HBx_P-B      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276791_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
KX276792_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276794_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAXWNLPKVLXKRTLGL
KX276796_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
KX276798_HBx_P-B      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAXGNLPKVLHKRTLGL
KX276799_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
KX276800_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276801_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276802_HBx_P-B      AXLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX276803_HBx_P-B      AHLSLRGLPVCAFSSXGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276804_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276805_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
KX276806_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLXKRTLGL
KX276807_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNXPWNLPKVLXKRTLGL
KX276809_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276810_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNXXGNLPKVLHKRTLGL
KX276811_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
KX276812_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHRNLPKVLHKRTLGL
KX276813_HBx_P-B      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
KX276814_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276817_HBx_P-B      XHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX276818_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
KX276819_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276820_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276821_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETXVNAXWNLPKVLHKRTLGL
KX276822_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276823_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX276824_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRLETTVNAHRNLPKVLHKRTLGL
KX276825_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLHKRTLGL
KX276827_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX276829_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
KX276830_HBx_P-B      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHXNLPKVLHKRTLGL
KX276858_HBx_P-B      XHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX429620_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX429622_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAHRNLPKVLHKRTLGL
KX429623_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTIGL
KX429628_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX429630_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KX429631_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX429648_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX429651_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX765841_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KX765856_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY417926_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY470830_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY470834_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY470838_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGP
KY470953_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY470956_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY470960_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY629635_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY629636_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881721_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881780_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881781_HBx_P-B      AHLSLRGPPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTPGL
KY881782_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881784_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881785_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881793_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881795_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881797_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881800_HBx_P-B      AHLSLRGLPVCAFSSAGPCALCFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881820_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881821_HBx_P-B      AHLSLRGPRVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881822_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881823_HBx_P-B      AHPSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881825_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881826_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881828_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881829_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881830_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881831_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881833_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
KY881835_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881836_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLSKVLHKRTLGL
KY881837_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881838_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881839_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881843_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLRL
KY881844_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881845_HBx_P-B      AHLSLRGLPVCAFSSARPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881853_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881856_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRALGL
KY881860_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAHRNLPKALHKRTLGL
KY881862_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881863_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881864_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881865_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881866_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAHRNLPKVLHKRTLGL
KY881899_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881902_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881944_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881945_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881946_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881953_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
KY881955_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC279268_HBx_P-B      AHLSLRGLPVCAFSFAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349868_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349869_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349870_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349871_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349872_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349874_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC349879_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC416037_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
LC461174_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
LC461175_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
LC603638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
LC677084_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
M54923_HBx_P-B        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059418_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059466_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059495_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059523_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059554_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059620_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059694_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059706_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059719_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059733_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF059737_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF621878_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674382_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674383_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLATALHKRTLGL
MF674385_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLYKRTLGL
MF674389_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNSHRNLPKVLHKRTLGL
MF674391_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MF674392_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
MF674393_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674394_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674395_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674396_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MF674400_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLITVLHKRTLGL
MF674401_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674406_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674407_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MF674409_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLAKVLHKRTLGL
MF674410_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLRKRTLGL
MF674413_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674415_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MF674416_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
MF674419_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674420_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MF674422_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MF674424_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674427_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MF674432_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674433_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674434_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674436_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674437_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674439_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674440_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674441_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MF674443_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674445_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPEVLHKRTLGL
MF674446_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674448_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLITVLHKRTLGL
MF674449_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MF674451_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLAKVLHKRTLGL
MF674452_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674453_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVNAHRNLPKVLHKRTLGL
MF674456_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674459_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674460_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674462_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MF674464_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674465_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674469_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674470_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674473_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MF674476_HBx_P-B      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674478_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MF674479_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPRVLHKRTLGL
MF674480_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MF674481_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674482_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MF674485_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPQVLHKRTLGL
MF674487_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAQRNLPKVLHKRTLGL
MF674488_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674491_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674492_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674495_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPRVLHKRTLGL
MF674500_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674507_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTRVLHKRTLGL
MF674508_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674509_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAHRNLPKVLHKRTLGL
MF674511_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTTVLHKRTLGL
MF674512_HBx_P-B      AHLSFRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MF674515_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLTKVLHKRTLGL
MG372436_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571321_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571322_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571323_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571324_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571325_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571326_HBx_P-B      AHLSLRGVPVCAFSSAGPCALRFTSARRVETTVNAHRNLPKVLHKRTLGL
MG571327_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571331_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGTLPKVLHKRTLGL
MG571333_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571334_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571338_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571339_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571340_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571341_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHENLPKVLHKRTLGL
MG571344_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571346_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAHRNLPKVLHKRTLGL
MG571347_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571348_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571350_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571351_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTLGNLPKVLHKRTLGL
MG571352_HBx_P-B      AHLSLRGLPVCAFSSPGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571353_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571354_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MG571355_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571356_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHRNLPTVLHKRTLGL
MG571357_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571360_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571361_HBx_P-B      AYLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MG571364_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571365_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571367_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571368_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
MG571369_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571370_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSAPSMATTVNAHRNLPKVLHKRTLGL
MG571371_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG571373_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHNRTLGL
MG571374_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MG571376_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MG826152_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MG826153_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488811_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488812_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRSTSARRMETTVNAHGNLPKVLHKRTLGL
MH488813_HBx_P-B      AHLSLRGLPVCAFISAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MH488814_HBx_P-B      AHLSLRGLPVCAFLSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
MH488816_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNTHGNLPKVLHKRTLGL
MH488817_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRLETTVNAHGNLPKVLHKRTLGL
MH488818_HBx_P-B      ANLSLRGPPVCAFSSAGPCALRFTSARRMETTVNAHQNLPKVLHKRTLGL
MH488819_HBx_P-B      AHLSLRGLPVFAFSSTGPCALRFTSARRLETTVNAHRSLPKVLHKRTLGL
MH488820_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MH488825_HBx_P-B      AHLSLRRLPVCAFSSAEPCALRFTSARHMETTVNAHRSLPKVLHKRTLGL
MH488826_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAHGNLPKVLHKRTLGL
MH488828_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETAVNAHRNLPKVLHKRTLGL
MH488832_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488833_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAQRNLPKVLHKRTLGL
MH488834_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
MH488835_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MH488836_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MH488840_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTPARRIETTVNAHGNLPKVLHKRTLRL
MH488841_HBx_P-B      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488842_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MH488843_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488845_HBx_P-B      AHLSLRRLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488846_HBx_P-B      AHLSLRGLPVCAFSSTGPCALHFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488848_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH488851_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKALHKRTLGL
MH488853_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNALGNLPKVLHKRTLGL
MH488855_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGTTVNAHGNLPKVLHKRTLGL
MH663473_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MH932712_HBx_P-B      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK052965_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQNLPKVLHKRTLGL
MK171272_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171280_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171284_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171285_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHQRTLGL
MK171290_HBx_P-B      AHLSLRGLPVCAFSSTGPCALRFTSARRXETTVNAHWNLPKVLHKRTLGL
MK171292_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNTHGNLPKVLHKRTLGL
MK171304_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171306_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171321_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MK171331_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MK171334_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MK171343_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171364_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171365_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171366_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHMRTLGL
MK171371_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLHKRTLGL
MK171376_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHRNLPKVLHKRTLGL
MK171377_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHVNLPKVLHKRTLGL
MK171383_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171395_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171396_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLYKRTLGL
MK171403_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171407_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171409_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAYRNLPKVLHKRTLGL
MK171413_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTIGL
MK171418_HBx_P-B      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAPGNLPKVLHKRTLGL
MK171419_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171420_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171421_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171427_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MK171460_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171466_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171467_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRVETTVNAHRNLPKVLYKRTLGL
MK171468_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171475_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171476_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMGATVNAHRNLPKVLHKRTLGL
MK171495_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171498_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171501_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171507_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171515_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171525_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLYKRTLGL
MK171528_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171536_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171542_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171545_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171555_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171579_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPRNLPKVLYKRTLGL
MK171589_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171592_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171599_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171603_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHWNLPKVLHKRTLGL
MK171606_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDHQNLPKVLHKRTLGL
MK171632_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171638_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHGNLPKVLHKRTLGL
MK171643_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK171644_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNNHWNLPKVLHKRTLGL
MK171649_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK534554_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARQVLPKVLHKRTLGL
MK534570_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK534572_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK534575_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRNLPKVLHKRTLGL
MK534576_HBx_P-B      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRTLPKVLHKRTIGL
MK534591_HBx_P-B    &nb