HBVdb

Dataset for protein LHBs of genotype A

[Download (right click)] [Sequences] [Repertoires]

1667 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KU605533_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604241_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KP168435_LHBs_P-A      MGLSWTVPLE-WGKNQSTSNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
AY161138_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB014370_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB064314_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB076678_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB076679_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116076_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116077_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116078_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116079_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116081_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116082_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116083_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPIKD
AB116084_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116085_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116086_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB116087_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116088_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116089_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116091_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB116092_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANANNPDWDLNPIKD
AB116093_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB116094_LHBs_P-A      MGGWTSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB126580_LHBs_P-A      MGGWSSKPRKGMGTNLSGSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB194950_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB194951_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB194952_LHBs_P-A      MGGRLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB205118_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB222707_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB241114_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB241115_LHBs_P-A      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFRANSNNPDWDLNPVKD
AB246335_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB246336_LHBs_P-A      MGGWSSKPHKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB300366_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDSNPIKD
AB300367_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB362931_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453982_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDSNPIKD
AB453983_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453984_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453986_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453987_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453988_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB453989_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB480036_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB480040_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB480041_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB549213_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697487_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697488_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697492_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697493_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697506_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697509_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFKPIKD
AB697511_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697512_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB775199_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937791_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AB937795_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNPIKD
AB937797_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937798_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF043560_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF090838_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF090839_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF090840_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF090841_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF090842_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF536524_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF537371_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF537372_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AJ309369_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AJ309370_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AJ309371_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNPIKD
AJ344115_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AJ627227_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM180624_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM184125_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM184126_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM282986_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM295798_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM494718_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY034878_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY152726_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY161139_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233274_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233275_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWNFNPIKD
AY233276_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPIKD
AY233278_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
AY233279_LHBs_P-A      MGGWPAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233280_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233281_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDRDFNPIKD
AY233282_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPIKD
AY233283_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233284_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233285_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233286_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233287_LHBs_P-A      MGGWSTKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233288_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233289_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY233290_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
AY373428_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY373429_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY373432_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY738139_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY738140_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY738141_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY738142_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY738143_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY862867_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
AY902775_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY903452_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934763_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
AY934764_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPIKD
AY934765_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934766_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934767_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934768_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934769_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934770_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934771_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934772_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934773_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY934774_LHBs_P-A      IGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
DQ020002_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
DQ020003_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
DQ298161_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
DQ298162_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
DQ298163_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
DQ298164_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKN
DQ298165_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNPIKD
DQ788725_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EF103278_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGYFPDHQLDPAFGANSNNPDWDFNPIKD
EF208113_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU054331_LHBs_C-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU185787_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDXDFNPIKV
EU185788_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKV
EU185789_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKV
EU366129_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU410082_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU414132_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU414133_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594384_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594385_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594386_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594387_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594389_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594391_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU747320_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859900_LHBs_P-A      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859907_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859921_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859932_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859934_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859938_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859939_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859944_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
EU859947_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859951_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPNHQLDPAFGANSNNPDWDFNPIKD
EU859952_LHBs_P-A      MGGWSSTPRIGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859953_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859954_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859955_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859956_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ349296_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ692554_LHBs_P-A      MGGWISKPRNGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ692557_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692558_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692559_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692561_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692562_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692563_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692564_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692565_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692566_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
FJ692567_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692571_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692572_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692575_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ692576_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692577_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692578_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692588_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692591_LHBs_P-A      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPXKD
FJ692592_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ692595_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFXPDHQLDPAFGANSNNPDWDFNHSKD
FJ692596_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692597_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692598_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692599_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692600_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692601_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKB
FJ692602_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692603_LHBs_P-A      MGGRXSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692604_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692605_LHBs_P-A      MGGXISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692606_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692607_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692608_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692609_LHBs_P-A      MGGRISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692610_LHBs_P-A      MGGRISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692611_LHBs_P-A      MGGRXSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692612_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FJ692613_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
FM199974_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199976_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199977_LHBs_P-A      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199978_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199979_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199980_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FM199981_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPTKD
FN545825_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPIKD
FN545826_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FN545828_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FN545829_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
FN545830_LHBs_P-A      MGGSLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
FN545831_LHBs_P-A      MGGWISKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FN545832_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPXKD
FN545833_LHBs_P-A      MGGSLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDVNPFKD
FN545834_LHBs_P-A      MGGXLXKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDVNPFKD
FN545835_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FN545836_LHBs_P-A      MGGWIAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FN545838_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDYNPIKD
GQ161813_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPIKD
GQ184323_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ184324_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPPGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ331046_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477462_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477463_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477464_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
GQ477465_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477466_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477468_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477469_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477472_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477473_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477475_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477477_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477478_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477479_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477480_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477482_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477486_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477487_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPIKD
GQ477488_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477490_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477491_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477493_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPLKD
GQ477494_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477495_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477497_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477498_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477500_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477501_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477502_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477503_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477504_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563545_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
GU563547_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
GU563548_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
GU563550_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563551_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563553_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563555_LHBs_P-A      MGGWSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563557_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HE576988_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HE576989_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HM011485_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HM363612_LHBs_P-A      MGGWISKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HM363613_LHBs_P-A      MGGRLPKPRKGMGTNLSVPNPLGFFPDLNLDPAFGANSNKPDWDFNPIKD
HM535200_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
HM535205_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPAHQLDPAFGANSNNPDWDFNPIKD
JF439720_LHBs_P-A      RGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
JF439721_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439722_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
JF439724_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439726_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439729_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439730_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439731_LHBs_P-A      RGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439734_LHBs_P-A      RGGWLPKPRKGMGTNLSVPNPLAFFPDHQLDPAFGANSNNPDWDFNPTKD
JF439735_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439738_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439739_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439742_LHBs_P-A      RGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGVNSNNPDWDFNPTKD
JF439743_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439744_LHBs_P-A      RGGWLPKPRKGMGTNLSVPNPLAFFPDHQLDPAFGANSNNPDWDFNPTKD
JF439746_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439747_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439748_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439762_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFSDHQLDPAFGANSNNTDWDFNPIKD
JF439767_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439768_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439774_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439820_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439821_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439822_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439824_LHBs_P-A      MGGWSSRPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439825_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIED
JF439828_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439829_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439831_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439832_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439833_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439834_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439835_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439836_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439839_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439840_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439841_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439842_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439843_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439845_LHBs_P-A      MGGWSSRPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439846_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFHPIKD
JF439847_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439849_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439850_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439851_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFHPIKD
JF439852_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNPIKD
JF439853_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFHPIKD
JF439855_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439857_LHBs_P-A      MGDWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439858_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439859_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439861_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNLIKD
JF439862_LHBs_P-A      TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439864_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439865_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439866_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439867_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439868_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439869_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439870_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439872_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439873_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439875_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439877_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439896_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439897_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439898_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439900_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439901_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439902_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439903_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439906_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439907_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439908_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439910_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439911_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKG
JF439912_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439913_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439914_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439915_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPLKD
JF439916_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439917_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439918_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439919_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439920_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439921_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNLLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439923_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439924_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439925_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439927_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439928_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439929_LHBs_P-A      MGGWSSKPRKGMGTNLSIPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439930_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439931_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439932_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439933_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439935_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439937_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNLIKD
JF439938_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439939_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439941_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPIKD
JF439942_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439943_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKG
JF439944_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439945_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439947_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439949_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDSNPIKD
JF439951_LHBs_P-A      MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439952_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439953_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439955_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
JF439956_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439957_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439958_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439959_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439960_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439961_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439963_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439965_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439968_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439970_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439971_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439972_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439973_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439975_LHBs_P-A      MGGWSSKPRKGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439976_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439977_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439979_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439981_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPLKD
JF439982_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439983_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439984_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439985_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439987_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439988_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439989_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439990_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439991_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439992_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439993_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF440020_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182318_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182320_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182324_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182327_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182328_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182330_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182331_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182332_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSSNPDWDFNPIKD
JN182333_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182334_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604128_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604136_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFGANSNNPDWDFNPVKD
JN604145_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604150_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604155_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
JN604156_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604160_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604162_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604163_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604165_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604167_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604169_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604171_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604172_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604176_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604179_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604181_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604183_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604186_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604188_LHBs_P-A      -GGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604190_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604193_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604194_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604197_LHBs_P-A      MGGQSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604214_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604217_LHBs_P-A      MGGWISTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
JN604220_LHBs_P-A      MGGWPSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604227_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604230_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604236_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604237_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
JN604240_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNPIKD
JN604242_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604249_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
JN604251_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604252_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604260_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
JN604266_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604268_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604269_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604270_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604274_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604277_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604282_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604285_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDXNPIKD
JN604288_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604290_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604293_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604298_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604299_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604300_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604302_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604305_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604307_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604308_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604309_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604314_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604317_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604319_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ023661_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ023662_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ023663_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ687529_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ687533_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707299_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707300_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707301_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707303_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707304_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707308_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707309_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707312_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707313_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707315_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707316_LHBs_P-A      MAGWSSKPRKGMGTNLSVPNHLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707317_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707318_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707319_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707322_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707323_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707324_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707326_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707328_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707332_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707337_LHBs_P-A      MGGWSSKPRKGVGTNLSVPNHLGFFPDHQLDPAFGDNSNNPDWDFNPIKD
JQ707338_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707339_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707343_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707344_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707346_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707347_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707348_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707349_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707350_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707351_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707352_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707354_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707358_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707361_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707366_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707367_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707368_LHBs_P-A      MGGWSSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707370_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707371_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707372_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707374_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707378_LHBs_P-A      MGGWSSKPRKGMGTNLYVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707380_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707388_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707391_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707395_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707397_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707398_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707399_LHBs_P-A      MGGWSSKPRKGMRTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707400_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNPIKD
JQ707402_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707406_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707408_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707411_LHBs_P-A      MGGWSSNPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707419_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707531_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707532_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707533_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707534_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707535_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707536_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707537_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707538_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
JQ707539_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707540_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707541_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707543_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707545_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707547_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707548_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707549_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707550_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707551_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707552_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707553_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707554_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707556_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707557_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707558_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707559_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707560_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707561_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707563_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707564_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707567_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707571_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707572_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707573_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707575_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707576_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707577_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707578_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707579_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707580_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707581_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707583_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707585_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707587_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707589_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707590_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707594_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707595_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707596_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707599_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707601_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPIKD
JQ707603_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707604_LHBs_P-A      MGGWSSKPHKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707605_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707606_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707607_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707609_LHBs_P-A      MGGWPSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707615_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707616_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707625_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPSKD
JQ707630_LHBs_P-A      MGGWSSKPRKGMGTNLSVPKPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707635_LHBs_P-A      MGGLSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707638_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWEFNPIKD
JQ707640_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707644_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707647_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707649_LHBs_P-A      MGGWSSKPRKGRGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707658_LHBs_P-A      MGGWSSKPRKGMGTNLSVHNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707663_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707676_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX096952_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX096953_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNPIKD
JX125364_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX125367_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX125368_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX154579_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX154580_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310722_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310723_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310730_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KC875260_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF170754_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214659_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214660_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214661_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214662_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214663_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214665_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF214666_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475982_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475983_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475984_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475985_LHBs_P-A      TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475986_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475988_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475991_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475992_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475993_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475994_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475995_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475996_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475997_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475999_LHBs_P-A      MGGWSSRPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476000_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476001_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476002_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476003_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGADSNNPDWDFNPIKD
KF476005_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476006_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476007_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476008_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNLLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476009_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476010_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476012_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476013_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476014_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476015_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKE
KF476016_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476017_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476018_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476020_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476021_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476022_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF476023_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF476024_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF476025_LHBs_P-A      MGGWSSKPREGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKX
KF476026_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNDPDWDFNPIKD
KF476027_LHBs_P-A      TGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF779210_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779211_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779213_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779221_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDQHLDPAFGANSNNPDWDFNPIKD
KF779231_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779232_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779238_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779239_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779252_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779254_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779255_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
KF779257_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779259_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779260_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779261_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779263_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779264_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWNFNPIKD
KF779265_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPIKD
KF779268_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779270_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779271_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779272_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779274_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779275_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779282_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779283_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779286_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779287_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779290_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779291_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779293_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779295_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779298_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779311_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779313_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779315_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779316_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779319_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779320_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGVKSNNPDWYFNPIKD
KF779321_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779322_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779323_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779324_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779325_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779330_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779332_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNLIKD
KF779335_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779336_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779349_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779358_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779365_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779370_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779381_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779383_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779384_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779386_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922406_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922407_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922408_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922409_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922414_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922417_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922420_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922424_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KF922429_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922435_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922436_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KJ010776_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ010777_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ586809_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843166_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843172_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843184_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843188_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843216_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854685_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854686_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854687_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854688_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KJ854689_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854690_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854691_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854692_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854693_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854694_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854695_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854696_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854698_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854699_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854700_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854701_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854703_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854706_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854707_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854708_LHBs_P-A      MGGWSSKPRKGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM519452_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KM519453_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KM519454_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM606737_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM606746_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM606748_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168422_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168423_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168424_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168425_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168426_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168427_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSYNPDWDFNPIKD
KP168428_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168429_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168430_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168431_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168432_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP168433_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
KP168434_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718085_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718086_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718087_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFXANSNNPDWDFNPIKD
KP718088_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718089_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718100_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718102_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP995108_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KR139743_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KR139744_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KR905425_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPIKD
KR905426_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
KR905427_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KR905429_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KR905430_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT151612_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KT151614_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT151615_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT151617_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KT347087_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT347091_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT347092_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT366467_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
KT366471_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749822_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749825_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749826_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749830_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KT749831_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749832_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749834_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749835_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749838_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749839_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNADWDFNPIMD
KU605532_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKE
KU605534_LHBs_P-A      MGGWSAKPRKGMGTNLFVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KU605536_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KU736918_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNNSKD
KU736919_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNNSKD
KU736920_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX276769_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KX357642_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357643_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357645_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357646_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357647_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357649_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX357650_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827293_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827298_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KY382410_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KY886219_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC051141_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC462120_LHBs_P-A      MGGWIGKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC517161_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LT992440_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LT992441_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANTNNPDWDFNPIKD
LT992448_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
M57663_LHBs_P-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF772344_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772345_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772346_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772347_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772348_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772350_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNQDWDFNPIKD
MF772351_LHBs_P-A      MGGWSSKPRTGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF772353_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925361_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925368_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925372_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925373_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925385_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925400_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF925407_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF979143_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MF979144_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF979146_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF979149_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MF979151_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MF979153_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MG877723_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MG877725_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464808_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464809_LHBs_P-A      MGGWPAKPRNGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464810_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464811_LHBs_P-A      MGGWSTKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464812_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464813_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464815_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPLKD
MH464816_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
MH464817_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MH464820_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464823_LHBs_P-A      MGGWPAKPRNGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464825_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPSKD
MH464829_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464830_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH580627_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MK512455_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPIKE
MK512456_LHBs_P-A      MGGCTSKLRKGKGKNVFVPNPMGFFPDLQLDQAFGANSNNPDWDFNPNKD
MK512457_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512462_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPTKD
MK512464_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512465_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512467_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512468_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512470_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
MK512471_LHBs_P-A      MGGSLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MK512472_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKC
MK512475_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
MN053840_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MN476101_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MN476102_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MN507849_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MN544634_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKQDWDFNPIKD
MN585097_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT114170_LHBs_P-A      MGGWSSKPHKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT210032_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MT426091_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426092_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSIKPDWDFNPIKD
MT426094_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426097_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426099_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT622525_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW567973_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW567975_LHBs_P-A      KGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW567976_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999482_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999483_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999484_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999485_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999489_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999498_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999503_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999505_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999506_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999507_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999512_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999514_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999517_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999520_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999522_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999526_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999527_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999533_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999538_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFGANSNNPDWDFNPIKD
MW999540_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999546_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999553_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999557_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
MW999568_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999570_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999573_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPIKD
MW999574_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
MW999578_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999580_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999585_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999592_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999597_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999598_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999601_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043025_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043026_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043027_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MZ043028_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043029_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043031_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043032_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043033_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043035_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043036_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043037_LHBs_P-A      MGGWISKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043038_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043039_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043041_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043042_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043043_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043044_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043045_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043046_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043047_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043048_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
MZ043049_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043050_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043052_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043053_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043054_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043055_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043056_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043057_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043058_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043059_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043060_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043061_LHBs_P-A      MGGWSSKPRKGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043062_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043063_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043065_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043067_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043068_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043069_LHBs_P-A      MGGWSSKPRKGMGTNLSIPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043070_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043071_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043072_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043073_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043074_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043075_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043076_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDRDFNPIKD
MZ043078_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043080_LHBs_P-A      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPXKD
MZ043081_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043082_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043085_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGADSNNPDWDFNPIKD
MZ043086_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043087_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043089_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043090_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043092_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043093_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043094_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043095_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043096_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043097_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OK998526_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON585698_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON585702_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFAANSNNPDWDFNPIKD
ON854557_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
ON854558_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854560_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854561_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854562_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854563_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
ON854564_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
ON854565_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854566_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854567_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854568_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854569_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
ON854570_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854571_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854573_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854574_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854578_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854579_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
ON854580_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854581_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854582_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854584_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPIKD
ON854585_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854587_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854589_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
ON854590_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854592_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854593_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854594_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OP256016_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPIKD
OP514936_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OR580946_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNHIKD
OR800013_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OY983040_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
OY983041_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDLNPIKD
OY983043_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
OY983044_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OY983046_LHBs_P-A      IGGWLPTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OY983048_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
OY983053_LHBs_P-A      MGGWIPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OY983055_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
OY983060_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
OY983062_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
OY983067_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
PP067021_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
X02763_LHBs_C-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
X51970_LHBs_P-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFGANSNNPDWDFNPIKD
X70185_LHBs_P-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
Z35717_LHBs_P-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
Z72478_LHBs_P-A        MGGWSLKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY128092_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477467_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477496_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604273_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604294_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779366_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP274927_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999486_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999500_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999577_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999587_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB116080_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB246337_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB246338_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453979_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453980_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB453981_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB480038_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697489_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697491_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697495_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697496_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697497_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697498_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697499_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697501_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697503_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697504_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697505_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697507_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB697508_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB775198_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB775200_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB775201_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937792_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937793_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937794_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AF043580_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AJ012207_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM295795_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM295797_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY862868_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU086721_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594383_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594388_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594390_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594392_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594393_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594394_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU594395_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859898_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859899_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859901_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859902_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859903_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859904_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859905_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859906_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859908_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859909_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859910_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859911_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859912_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859913_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859914_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859915_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859916_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859917_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859918_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859919_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859920_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859922_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859923_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859924_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859925_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859926_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859927_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859928_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859929_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859930_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859931_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859935_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859936_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859937_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859942_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ349224_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ414522_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ477461_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563546_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563554_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563558_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GU563562_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439752_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439753_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439754_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439755_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439756_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439757_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439758_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439759_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439761_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439763_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439764_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439765_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439766_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604158_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604173_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604178_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604180_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604184_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604185_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604191_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604228_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604257_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604262_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604279_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604283_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604291_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604292_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604303_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707546_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707555_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707565_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707566_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707610_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707611_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707612_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707613_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707614_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707617_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707618_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707619_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707620_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707621_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707622_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707623_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707624_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707626_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707629_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707631_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707632_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707634_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707637_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310721_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310724_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310725_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310731_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX310732_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779227_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779240_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779243_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779244_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779245_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779251_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779253_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779256_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779258_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779262_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779266_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779279_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779299_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779304_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779310_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779329_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779337_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779338_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779339_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779350_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779351_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779355_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779360_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779369_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779378_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779379_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779385_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843182_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843186_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843192_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843214_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843217_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843218_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854710_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM606742_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KM606749_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP274925_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP274928_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749836_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749837_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749840_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749850_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KY003230_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
L13994_LHBs_P-A        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC074724_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC311241_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC311242_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC311243_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC430617_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC458430_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC458431_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC592168_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC592169_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC592170_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC677081_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC677082_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
LC677083_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH932713_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426093_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426098_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999475_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999477_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999478_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999479_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999481_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999487_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999488_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999490_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999491_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999492_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999493_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999495_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999496_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999497_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999499_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999501_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999502_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999504_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999508_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999509_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999511_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999513_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999515_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999516_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999518_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999521_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999524_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999528_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999529_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999530_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999531_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999532_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999534_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999535_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999537_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999539_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999541_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999545_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999547_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999548_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999549_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999550_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999551_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999554_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999556_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999558_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999559_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999560_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999562_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999564_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999565_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999566_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999572_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999579_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999583_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999584_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999586_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999589_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999590_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999596_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999599_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999600_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043040_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OP611181_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OR580945_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OY983052_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859940_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859946_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859948_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859949_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604276_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749829_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749844_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB480039_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDSNPIKD
JN604216_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999480_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999542_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999563_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999571_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AB937796_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692590_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KF922426_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KF922427_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KF922428_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KJ843183_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854697_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854702_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854704_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854705_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043030_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827297_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AY707087_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON093162_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM295799_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
AM410963_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859945_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707659_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707661_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707662_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707664_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707665_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707667_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707669_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707670_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707672_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707674_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707675_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707681_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999519_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999567_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999595_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859933_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859941_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
EU859943_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604204_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604304_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779297_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779333_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749824_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
GQ331047_LHBs_P-A      MGGWSSTPRIGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
FJ692574_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692579_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692580_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692581_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692582_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692583_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692584_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
FJ692585_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
MK512460_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
MK512473_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKD
GQ477484_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604164_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604200_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604247_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604297_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604315_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779326_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779334_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779346_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779347_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779352_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779367_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779373_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043084_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707544_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426096_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439736_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439737_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439777_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439769_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439838_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439844_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439848_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439854_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439856_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439837_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439860_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439871_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439874_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439876_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439879_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439880_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439881_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439882_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439883_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439878_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439909_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439899_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439904_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439905_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439922_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439934_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439936_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439940_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439946_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439948_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439950_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439954_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439962_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439967_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439969_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439974_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439978_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439980_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JF439986_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707639_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707641_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707642_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707643_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707645_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707646_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707648_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707650_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707651_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707652_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707653_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707654_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707655_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707656_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182321_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182322_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182323_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182325_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182326_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN182329_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604306_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707307_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779277_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779312_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779328_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779331_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779342_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779354_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779359_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779361_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779362_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779363_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779364_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779368_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779375_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827294_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827295_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX827296_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MZ043083_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JN604261_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT366469_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MT426088_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999544_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707627_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707633_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707636_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OP256015_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OK274310_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779234_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707302_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707311_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707320_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707333_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707341_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707342_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707314_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707321_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707310_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707330_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707331_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707336_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707355_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707356_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707363_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707365_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707357_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707353_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707359_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707360_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707369_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707362_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707364_LHBs_P-A      MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707373_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707375_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707376_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707377_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707379_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707381_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707382_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707383_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707385_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707386_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707387_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707389_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707390_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707392_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707393_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707394_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707396_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707403_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707404_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707405_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707407_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707409_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707410_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707412_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707413_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707415_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707416_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707417_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707418_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707420_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707414_LHBs_P-A      MGGWSSNPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707542_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707569_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707562_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707570_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707568_LHBs_P-A      MGGWSSKPRKGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707586_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707592_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JQ707608_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX154581_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
JX154582_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475987_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475989_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475990_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF475998_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476004_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF476011_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT347088_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KU605535_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KX648548_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464828_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779215_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779246_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779247_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779248_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718093_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779249_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779269_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779276_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779309_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779372_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779374_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779317_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779273_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779280_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779281_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779305_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779306_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779307_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779308_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779371_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779344_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779345_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779348_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779294_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF779356_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922415_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922416_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922418_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922419_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922421_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KF922425_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPVKD
KF922430_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KF922437_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KJ010778_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843173_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ843215_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
OK106253_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999494_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999510_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999555_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999576_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999591_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KJ854709_LHBs_P-A      MGGWSSKPRKGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718090_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718091_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718092_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718094_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718095_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718096_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718097_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718098_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718099_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KP718101_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT366466_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPIKD
KT366468_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT366470_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999476_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749842_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749843_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MT426095_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KT749846_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749847_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KT749849_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
KU605537_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KU605538_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
KU605539_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPIKD
MH464814_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464818_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464819_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464821_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464822_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464824_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464826_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH464827_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH580639_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH580642_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MH580643_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999523_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999525_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999543_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999561_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999588_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999581_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999594_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999536_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999552_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999575_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999582_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFGANSNNPDWDFNPIKD
MW999593_LHBs_P-A      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
MW999569_LHBs_P-A      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854583_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
ON854586_LHBs_P-A      MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKD
                        .           .*    :  .: .  ::. .*  .: . *   :    

KU605533_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
JN604241_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
KP168435_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGLLGWNPQAQGILHTVPTIPPPASTNRQ
AY161138_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPSASTNRQ
AB014370_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB064314_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB076678_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB076679_LHBs_P-A      RWPQANQVGVGAFGPGFTPPHGGVLGWNPQAQGILTTVPAVPPPASTNRQ
AB116076_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB116077_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB116078_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB116079_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB116081_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB116082_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
AB116083_LHBs_P-A      HWPQANQVGVGAFGPGLTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
AB116084_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB116085_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILXTVPAVPPPASTNRQ
AB116086_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB116087_LHBs_P-A      HWPQANQVGVGAYGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB116088_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB116089_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPASTNRQ
AB116091_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
AB116092_LHBs_P-A      HWPQANQVGVGAFGPGLTPPHGGVLGWSPQAQGILATVPTVPPPASTNRQ
AB116093_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAGPPPASTNRQ
AB116094_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGGSPQAQGILATVPAVPPPASTNRQ
AB126580_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB194950_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASANRQ
AB194951_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASTNRQ
AB194952_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASTNRQ
AB205118_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB222707_LHBs_P-A      HWPAAKQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSIIPPPASTNRQ
AB241114_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB241115_LHBs_P-A      PWPQANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPASTNRQ
AB246335_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB246336_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB300366_LHBs_P-A      HWPVANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB300367_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB362931_LHBs_P-A      RWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB453982_LHBs_P-A      HWPEANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB453983_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVSTIPPPASTNRQ
AB453984_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB453986_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB453987_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPPASTNRQ
AB453988_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB453989_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB480036_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB480040_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB480041_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB549213_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697487_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697488_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697492_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697493_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697506_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697509_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697511_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB697512_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB775199_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AB937791_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AB937795_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPPASTNRQ
AB937797_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSXQAQXIXTTVSTIPPPASTNRQ
AB937798_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AF043560_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AF090838_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASANRQ
AF090839_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AF090840_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AF090841_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASANRQ
AF090842_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AF536524_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AF537371_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AF537372_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTNPPPASTNRQ
AJ309369_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AJ309370_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AJ309371_LHBs_P-A      HWPAANQVGAGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AJ344115_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPTIPPPASTNRQ
AJ627227_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AM180624_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTMVPAVPPPASTNRQ
AM184125_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTLPAVPPPASTNRQ
AM184126_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
AM282986_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVSTIPPPASTNRQ
AM295798_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AM494718_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY034878_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY152726_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVSTIPPPASTNRQ
AY161139_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPSASTNRQ
AY233274_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPTASTNRQ
AY233275_LHBs_P-A      HWPQANQVGVGAYGPGLTPPHGGVLGWSPQAQGILTTAPVVPPPASTNRQ
AY233276_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPPVPPPASTNRQ
AY233278_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY233279_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGVLATVPPVLPPASTNRQ
AY233280_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAMPPPASTNRQ
AY233281_LHBs_P-A      HWPQANQVGVGAYGPGFTPPHGGVLGWSPQAQGILTTAPVVPPPASTNRQ
AY233282_LHBs_P-A      HWPEANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
AY233283_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
AY233284_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATAPVVPPPASTNRQ
AY233285_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
AY233286_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVLTIPPPASTNRQ
AY233287_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPPASTNRQ
AY233288_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASANRQ
AY233289_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
AY233290_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPTVPPPASTNRQ
AY373428_LHBs_P-A      HWPQANQVEMGAFGPGFTPPHGGVLGWSPQAQGILATVPRVPHCASTNRQ
AY373429_LHBs_P-A      QWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
AY373432_LHBs_P-A      HWPQANQVGVGAFWPGLTPPHGGVLGWSPHAQGILATAPAVPPPASTNRQ
AY738139_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY738140_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY738141_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY738142_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY738143_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY862867_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
AY902775_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWNPQAQGILTTVSTIPPPASTNRQ
AY903452_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934763_LHBs_P-A      HWPKANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPTASTNRQ
AY934764_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGISTTVPAVPPPACTNRQ
AY934765_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASXNRQ
AY934766_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934767_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934768_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934769_LHBs_P-A      RWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934770_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934771_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASANRQ
AY934772_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934773_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
AY934774_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPTVPPPASTNRQ
DQ020002_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGILGWSPQAQGILATLPAVPPPASTNRQ
DQ020003_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
DQ298161_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
DQ298162_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
DQ298163_LHBs_P-A      NWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
DQ298164_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
DQ298165_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
DQ788725_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EF103278_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
EF208113_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU054331_LHBs_C-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
EU185787_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU185788_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU185789_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU366129_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILXTXPAVPPPASTNRQ
EU410082_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPPASTNRQ
EU414132_LHBs_P-A      HWPAAKQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU414133_LHBs_P-A      HWPAAKQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594384_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594385_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594386_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594387_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594389_LHBs_P-A      HWPAASQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU594391_LHBs_P-A      HWPTANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU747320_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859900_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859907_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859921_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859932_LHBs_P-A      HWPTANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859934_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859938_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859939_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVSTIPPPASTNRQ
EU859944_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859947_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859951_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859952_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPKVPPPASTNRQ
EU859953_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859954_LHBs_P-A      HWPTANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859955_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
EU859956_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
FJ349296_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGILGWSPQAQGTLTTVPTVPPPASTNRQ
FJ692554_LHBs_P-A      HWPQAKQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPVSANRQ
FJ692557_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692558_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692559_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692561_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692562_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692563_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692564_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATMPAVXPPASTNRQ
FJ692565_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATXPAVPPPASTNRQ
FJ692566_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
FJ692567_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
FJ692571_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692572_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692575_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGXLXTVPAVPPPASXNRQ
FJ692576_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692577_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692578_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPVVPPPASTNRQ
FJ692588_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
FJ692591_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPASTNRQ
FJ692592_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGIVATVPAVPPPASTNRQ
FJ692595_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692596_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692597_LHBs_P-A      HWPQAKQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692598_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692599_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692600_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692601_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692602_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGXLTTVPAVPPPASTNRQ
FJ692603_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692604_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692605_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692606_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692607_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692608_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692609_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPLASTNRQ
FJ692610_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPLASTNRQ
FJ692611_LHBs_P-A      PWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692612_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FJ692613_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAIPPPASTNRQ
FM199974_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGKLATLPAVPPPASTNRQ
FM199976_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FM199977_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FM199978_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FM199979_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FM199980_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FM199981_LHBs_P-A      HWPQSNQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
FN545825_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545826_LHBs_P-A      HWPAANQVGVGAFGPGXTPPHGGILGWSPQAQGILTTVPTVPPPASTNRQ
FN545828_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545829_LHBs_P-A      HWSQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545830_LHBs_P-A      HWSQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545831_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASANRQ
FN545832_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRR
FN545833_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASTNRQ
FN545834_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545835_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
FN545836_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPASANRQ
FN545838_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGISTTVPAVPPPASTNRQ
GQ161813_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAATNRQ
GQ184323_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ184324_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ331046_LHBs_P-A      HWPKANQVGVGAFGPGFTPPHGGVLGWSPQAQGLLTTLPKVPPPASTNRQ
GQ477462_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477463_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477464_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVSTIPPPASTNRQ
GQ477465_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477466_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477468_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477469_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477472_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477473_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477475_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477477_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477478_LHBs_P-A      HWPAANQVGAGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477479_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477480_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477482_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477486_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477487_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477488_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477490_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477491_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477493_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGIWTTVSTIPPPASTNRQ
GQ477494_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477495_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTNPPPASANRQ
GQ477497_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477498_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477500_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477501_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477502_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477503_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GQ477504_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GU563545_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
GU563547_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
GU563548_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATLPAVPPPASTNRQ
GU563550_LHBs_P-A      HWPTANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GU563551_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GU563553_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
GU563555_LHBs_P-A      HWPTANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRH
GU563557_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
HE576988_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
HE576989_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
HM011485_LHBs_P-A      HWPQANQVGVGAFGPGLTPPHGGVLGWSPQAQGILTTVPAVPPPASTNRQ
HM363612_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASTNRQ
HM363613_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQSLLLIVPAVPPPASTNRQ
HM535200_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
HM535205_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPTASTNRQ
JF439720_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439721_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439722_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439724_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439726_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439729_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439730_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439731_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439734_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439735_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439738_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439739_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439742_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439743_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439744_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439746_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439747_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439748_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439762_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439767_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASANRQ
JF439768_LHBs_P-A      HWQAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASANRQ
JF439774_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASANRQ
JF439820_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439821_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQVQGILTTVSTIPRPASTNRQ
JF439822_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439824_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439825_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439828_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439829_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439831_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILATVSTIPPPASTNRQ
JF439832_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439833_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439834_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439835_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGDILGWSPQAQGILTTVSTIPPPASTNRQ
JF439836_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439839_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439840_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439841_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439842_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439843_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439845_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439846_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439847_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQARGILTTVPTIPPPASTNRQ
JF439849_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439850_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439851_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439852_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439853_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439855_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439857_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439858_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPLPASTNRQ
JF439859_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439861_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439862_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439864_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439865_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439866_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439867_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439868_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439869_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439870_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439872_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439873_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439875_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439877_LHBs_P-A      HWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASTNRQ
JF439896_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439897_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439898_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439900_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439901_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRH
JF439902_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439903_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439906_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439907_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439908_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439910_LHBs_P-A      HWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGTLTTVPAIPPPASTNRQ
JF439911_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439912_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439913_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439914_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGTLTTVSTIPPPASTNRQ
JF439915_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439916_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439917_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439918_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439919_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439920_LHBs_P-A      HWPAANQVGVGAFGPGLIPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439921_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439923_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439924_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439925_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439927_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439928_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439929_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439930_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439931_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439932_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439933_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439935_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439937_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439938_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILATVSTIPPPASTNRQ
JF439939_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439941_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439942_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439943_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439944_LHBs_P-A      HWPAANQVGVGAFGPGLTPPRGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439945_LHBs_P-A      HWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPASTNRQ
JF439947_LHBs_P-A      HWPAANQVGVGAFGPRLTPPHGGILGWSPQAQGILTTVST