HBVdb

Dataset for protein HBx of genotype A

[Download (right click)] [Sequences] [Repertoires]

1094 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


ON585702_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
AF143298_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KU605535_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB014370_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB064314_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB076678_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB076679_HBx_P-A      MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AB116076_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHG
AB116077_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116078_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116079_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116081_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116082_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116083_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
AB116084_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116085_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116086_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHG
AB116087_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116088_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116089_HBx_P-A      MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116090_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116091_HBx_P-A      MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHG
AB116092_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHG
AB116093_HBx_P-A      MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AB116094_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
AB194950_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB194951_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
AB194952_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
AB205118_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB241114_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
AB241115_HBx_P-A      MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHG
AB246317_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB246335_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB246336_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHG
AB246337_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
AB246338_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB362931_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB453984_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453986_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB453987_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB453988_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB453989_HBx_P-A      MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB480040_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697487_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697498_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937791_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
AB937795_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB937797_HBx_P-A      MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF043560_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AF043580_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090838_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090841_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
AF143302_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF297621_HBx_P-A      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AF297622_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF297623_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGSLGTLSSPSPSAVPSDHG
AF297624_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AF297625_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AJ309369_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ309371_HBx_P-A      MTARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ344115_HBx_P-A      MAARLFCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ627226_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
AJ627227_HBx_P-A      MAARLCCQLDPSRDVLCLRPVXAESRGRPLSGPLGALSSPSPSAVPAVHG
AM180624_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGXLPSPSPSAVPTDHG
AM184125_HBx_P-A      MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AM184126_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
AM494718_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY034878_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHG
AY128092_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHG
AY152726_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY161138_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161142_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY233274_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233275_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233276_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233278_HBx_P-A      MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHG
AY233279_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233280_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
AY233281_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233282_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233283_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233285_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233286_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY233288_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AY233290_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHG
AY373428_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY373429_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373432_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY738139_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738140_HBx_P-A      MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738141_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738142_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY862868_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHG
AY902775_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
AY903452_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934763_HBx_P-A      MAARMYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDDG
AY934764_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AY934765_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934766_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934767_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
AY934769_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHG
AY934770_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934771_HBx_P-A      MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY934772_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHG
AY934773_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934774_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
DQ020002_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
DQ020003_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
DQ298161_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADRG
DQ298162_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ298163_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ315784_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315785_HBx_P-A      MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315786_HBx_P-A      MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
DQ788728_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EF103278_HBx_P-A      MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLG
EF208113_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU054331_HBx_C-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHG
EU366129_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
EU414133_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594385_HBx_P-A      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594387_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU747320_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859900_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859901_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859903_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859906_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859917_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859927_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859932_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
EU859934_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSTVPADHG
EU859938_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859941_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859944_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
EU859948_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859949_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859952_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
FJ349224_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ349296_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
FJ692554_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
FJ692557_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692558_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692559_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692561_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692562_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNG
FJ692563_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692564_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692566_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHG
FJ692567_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692570_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYG
FJ692571_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692572_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHG
FJ692573_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692574_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692575_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
FJ692576_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692577_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692587_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSTSPSAVPSDHG
FJ692590_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692592_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692593_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692595_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692597_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692598_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692599_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692601_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692602_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692603_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPAXHG
FJ692605_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692606_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692607_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FJ692608_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692609_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692610_HBx_P-A      MAXRLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692612_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FJ692613_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSASPSAVPTVHG
FJ904411_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
FM199974_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHG
FM199975_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199976_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199977_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199979_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199981_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FN545825_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGSVSSPSPSAVPTDHG
FN545826_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545828_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVPTDHG
FN545829_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545830_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPISSPSPSAVSTDHG
FN545831_HBx_P-A      MAARLYCQLDSSRNVLCLRPVDAESRGRPLSGPLGALSSPSPSAVPTDHG
FN545832_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545833_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545834_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545835_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545836_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FN545837_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545838_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545839_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
GQ161813_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ184323_HBx_P-A      MAARLYSQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
GQ184324_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
GQ331046_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477462_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477463_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477465_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477466_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVPADHG
GQ477469_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPAVHG
GQ477472_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477473_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477474_HBx_P-A      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477475_HBx_P-A      MAARLYCQLDPSRDVLCLRAVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477478_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477479_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESSGRPLSGPLGTLSSPSPSAVPTDHG
GQ477480_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
GQ477486_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477487_HBx_P-A      MAARLYCQLDPSRDVFCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477488_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477490_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
GQ477494_HBx_P-A      MAAKLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477498_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477499_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
GQ477500_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTFSSPSPSAVPADYG
GQ477502_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563545_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563546_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVPADHG
GU563547_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563550_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563551_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563557_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563562_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HM011485_HBx_P-A      MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHG
HM535200_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHG
HM535205_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
JN182318_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182321_HBx_P-A      TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182322_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182323_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182324_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182325_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182330_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JQ707299_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707306_HBx_P-A      MADRLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707309_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707317_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707329_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707335_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707340_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
JQ707348_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707351_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707353_HBx_P-A      MAARLYCQLDPSRDVLCFRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707362_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707368_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707371_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707374_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707376_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707380_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707383_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707397_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707400_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707403_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707405_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707411_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707414_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGSLGTLSSPSPSAVPADHG
JQ707418_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707532_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
JQ707535_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707537_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707543_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707551_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707560_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707568_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707581_HBx_P-A      VAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707582_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707589_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLETLSSPSPSAVPADHG
JQ707592_HBx_P-A      MAAGLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707604_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHG
JQ707611_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707617_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707625_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707626_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707642_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTLSSPSPSAVPADHG
JQ707659_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707672_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX154579_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154582_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX310722_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
JX310723_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KC875251_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875252_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875253_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875254_HBx_P-A      MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875255_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875256_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875257_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHG
KC875258_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875259_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875260_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHG
KF214657_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214658_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214659_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF214660_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHG
KF214661_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214662_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
KF214663_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214665_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214666_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF922406_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922414_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922417_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922420_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922424_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922429_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922433_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922434_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922435_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922437_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010776_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ843172_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843173_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHG
KJ843183_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ843184_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
KJ843188_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843215_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ854685_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854686_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KJ854687_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854688_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KJ854689_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854690_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHG
KJ854691_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ854692_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
KJ854694_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854695_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854696_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854699_HBx_P-A      MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854700_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHG
KJ854701_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854703_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854704_HBx_P-A      MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854705_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854707_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHG
KJ854709_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM243029_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KM519452_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KM519454_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606737_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
KM606748_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168422_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
KP168423_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHG
KP168424_HBx_P-A      MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
KP168425_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168426_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHG
KP168427_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHG
KP168428_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHG
KP168429_HBx_P-A      MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168430_HBx_P-A      MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168431_HBx_P-A      MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168432_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168433_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168434_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHG
KP168435_HBx_P-A      MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHG
KP718085_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHG
KP718086_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP718090_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718092_HBx_P-A      MAARLXCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718093_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718094_HBx_P-A      MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718102_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP995108_HBx_P-A      MAAVLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR905425_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KR905426_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905427_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905429_HBx_P-A      MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905430_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151611_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHG
KT151612_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151613_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHG
KT151614_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHG
KT151615_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151616_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151617_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151618_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KT347087_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHG
KT347088_HBx_P-A      MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KT347091_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT749822_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
KT749825_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749833_HBx_P-A      MAARLCCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749840_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749842_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KU605532_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
KU605533_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605534_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605536_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605537_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU736918_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736919_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736920_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
KX276769_HBx_P-A      MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHG
KX357643_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357644_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357645_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357647_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHG
KX357649_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHG
KX357650_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KX648547_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KX648549_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KX827298_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
L13994_HBx_P-A        MGARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC051141_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
LC462120_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
LT992441_HBx_P-A      MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHG
M57663_HBx_P-A        IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
MF772344_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772345_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
MF772346_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MF772347_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772348_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772350_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772351_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MF925362_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHG
MF925368_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
MF925372_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHG
MF925373_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
MF925385_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925400_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHG
MF925407_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MG877723_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464808_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHG
MH464809_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464810_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464811_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464812_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHG
MH464813_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464817_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MH464825_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH580627_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MK512456_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512457_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512458_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHG
MK512461_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512462_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512463_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512464_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHG
MK512465_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHG
MK512466_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512468_HBx_P-A      MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHG
MK512469_HBx_P-A      MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHG
MK512470_HBx_P-A      MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHG
MK512471_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHG
MK512472_HBx_P-A      MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
MK512474_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512475_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512476_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512477_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHG
MN053840_HBx_P-A      --ARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
MN476101_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLARPLGSVSSPSPSAVPSDHG
MN476102_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
MN544634_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MN585096_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVPADHG
MN585097_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
MT114170_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPPAVPSDHG
MT210032_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT210034_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGXLSSPSPSAVPSDHG
MT426088_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MT426090_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426092_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
MT426093_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTFSSPSPSAVPADHG
MT426097_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426098_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESPGRPLSGPLGTLSSPSPSAVPADHG
MT622525_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVSPDHG
MW567976_HBx_P-A      MAARLCCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043025_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043026_HBx_P-A      MAARLYCQLDPSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043027_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043028_HBx_P-A      MAARLYCQLDPSRDVLCLRPVDAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043029_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
MZ043030_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MZ043031_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043032_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043033_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGPLSSPSQSAVPAVHG
MZ043034_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043035_HBx_P-A      MAARMYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043036_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043037_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043038_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043039_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043041_HBx_P-A      MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043043_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043044_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
MZ043045_HBx_P-A      MAARLYCQLDPARDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043046_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043047_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
MZ043048_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043049_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043050_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043052_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPADHG
MZ043053_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTISSPSPSAVPADHG
MZ043054_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
MZ043055_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043056_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPAVHG
MZ043057_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPAVHG
MZ043058_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043059_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043060_HBx_P-A      MAARLYCQLDPSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043062_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043063_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043064_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043065_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043067_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043068_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043069_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
MZ043071_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043073_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043074_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043075_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043076_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
MZ043077_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043078_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
MZ043080_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043081_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043085_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043086_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
MZ043087_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043088_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043089_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043092_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043093_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043095_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043096_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGDESRGRPLARPLGAVSSPSPSAVPSDHG
MZ043097_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ093431_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
OK143478_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143482_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143492_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143495_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK274310_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
OK998526_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OM304326_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
ON585698_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
ON585700_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
X51970_HBx_P-A        MATRLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X70185_HBx_P-A        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
AY233287_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934768_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357646_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX648548_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464815_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464828_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
JQ023660_HBx_P-A      MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023661_HBx_P-A      MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023662_HBx_P-A      MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023663_HBx_P-A      MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AB126580_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB222707_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300366_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480039_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB549213_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697492_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697493_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697495_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775198_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775199_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775200_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775201_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937792_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937793_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937794_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090839_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090840_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF536524_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ012207_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM282986_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295795_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295797_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295798_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295799_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM410963_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY707087_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY862867_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ788725_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU086721_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185786_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185787_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185788_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185789_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594383_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594388_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594389_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594390_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594391_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594392_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594393_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594394_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594395_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859898_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859899_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859902_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859904_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859905_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859907_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859908_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859909_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859910_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859911_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859912_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859913_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859914_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859915_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859916_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859918_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859919_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859920_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859921_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859922_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859923_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859924_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859925_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859926_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859928_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859929_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859931_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859935_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859936_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859937_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859939_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859940_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859942_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859945_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859946_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859947_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859950_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859951_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859953_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859954_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859956_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ414522_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477461_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477464_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477467_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477470_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477482_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477497_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477503_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477504_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563553_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563554_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563558_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576988_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576989_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687529_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687533_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707531_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707538_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707539_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707541_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707542_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707544_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707545_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707546_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707547_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707548_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707549_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707550_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707552_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707553_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707554_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707555_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707556_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707557_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707558_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707559_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707562_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707563_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707564_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707566_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707567_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707572_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707573_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707585_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707591_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707594_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707609_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707612_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707614_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707615_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707616_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707619_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707620_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707621_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707623_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707624_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707628_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707629_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707631_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707632_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707633_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707634_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707635_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707636_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707637_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707638_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707639_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707640_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707641_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707643_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707645_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707646_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707647_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707649_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707651_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707652_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707653_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707654_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707655_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707656_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX096952_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX096953_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843182_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843186_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843217_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843218_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854708_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854710_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606742_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606746_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606749_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP274928_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718087_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718088_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718089_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718095_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718096_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718097_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718098_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718099_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718101_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749830_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749831_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749835_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749837_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749843_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749844_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827293_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827294_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827295_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827296_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827297_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY003230_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY382410_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC430617_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458430_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458431_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC517161_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592168_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592169_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592170_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426094_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426095_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426099_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043040_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043061_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043070_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043082_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043083_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043084_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043090_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143483_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143484_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
ON093162_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X02763_HBx_C-A        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
Z72478_HBx_P-A        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ349222_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477493_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116080_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300367_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453979_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453980_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453982_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480038_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480041_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697488_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697489_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697491_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697496_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697497_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697499_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697501_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697503_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697504_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697505_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697508_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697509_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697511_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697512_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937798_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ586809_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY886219_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC074724_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311241_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311242_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311243_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677081_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677082_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677083_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MH932713_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426096_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480036_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AF090842_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366469_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366471_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB453981_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697506_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697507_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB453983_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843166_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843192_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843214_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
OK106253_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB937796_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
EU594384_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU594386_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859933_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859943_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
GU563555_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749824_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749829_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749838_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
AF537371_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF537372_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ627228_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ904434_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477476_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477496_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043042_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143477_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ309370_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX357642_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY161139_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161143_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161144_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY233284_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233289_HBx_P-A      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MF925361_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY738143_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143498_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHG
KP274925_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749850_HBx_P-A      MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ692596_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692600_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692604_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
DQ298164_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ298165_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859955_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477468_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477484_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707533_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707534_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707561_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707565_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707569_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707574_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707575_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707576_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707577_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707578_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707579_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707580_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707583_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707584_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707586_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707587_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707588_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707590_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707593_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707595_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707596_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707597_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707599_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707600_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707601_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707602_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707603_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707605_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707606_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707607_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707608_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707622_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707627_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707630_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707610_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749836_HBx_P-A      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ331047_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
KP274927_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ692578_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692579_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692580_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692581_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692582_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692583_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692584_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692585_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922426_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922427_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922428_HBx_P-A      MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692565_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692586_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692588_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692591_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692611_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FM199980_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563548_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512459_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512473_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FN545840_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
GQ477477_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043094_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
V00866_HBx_P-A        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
Z35717_HBx_P-A        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477495_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043072_HBx_P-A      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477501_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043051_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477491_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JN182328_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182331_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182332_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182333_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JQ707300_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707301_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707302_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707303_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707304_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707305_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707307_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707308_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707310_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707311_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707312_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707313_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707314_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707315_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707316_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707319_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707320_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707321_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707322_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707323_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707324_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707325_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707326_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707327_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707328_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707330_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707331_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707332_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707333_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707334_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707336_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707337_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707338_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707339_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707341_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707342_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707343_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707344_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707345_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707346_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707347_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707349_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707350_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707352_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707354_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707355_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707356_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707357_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707358_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707359_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707360_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707361_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707363_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707364_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707365_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707366_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707367_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707369_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707370_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707318_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707372_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707373_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707375_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707377_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707378_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707379_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707381_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707382_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707384_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707386_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707387_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707388_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707390_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707391_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707392_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707393_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707394_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707395_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707396_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707399_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707404_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707406_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707407_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707408_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707409_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707410_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707412_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707413_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707415_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707416_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707417_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707419_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707420_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707389_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707398_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707385_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707402_HBx_P-A      MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707536_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707540_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707658_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707661_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707662_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707663_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707664_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707665_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707667_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707669_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707670_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707674_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707675_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707676_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707681_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707613_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707618_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707644_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707648_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707598_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707650_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX154580_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154581_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
KF922407_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922408_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922409_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922415_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922416_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922418_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922419_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922421_HBx_P-A      MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922425_HBx_P-A      MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922430_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922431_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922436_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ010777_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010778_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426091_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ843216_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
MF772353_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854697_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854702_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854706_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KM519453_HBx_P-A      MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KT347092_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP718091_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718100_HBx_P-A      MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT366466_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KT366467_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905431_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366468_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366470_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT749826_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749832_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749834_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749839_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749846_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749847_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749849_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MN507849_HBx_P-A      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
KU605538_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605539_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
MG877724_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MG877725_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464814_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464818_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464830_HBx_P-A      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH580639_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580642_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580643_HBx_P-A      MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
                          :  * *.: ::: :* :  **  * :  .     :.: . :.   *

ON585702_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF143298_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU605535_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB014370_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB064314_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB076678_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB076679_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB116076_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116077_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116078_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116079_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB116081_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116082_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AB116083_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116084_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNTHQILPKVLHKRTLGL
AB116085_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AB116086_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB116087_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AB116088_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAPQVLPKVLHKRTLGL
AB116089_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
AB116090_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB116091_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB116092_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
AB116093_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB116094_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB194950_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB194951_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB194952_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
AB205118_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB241114_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB241115_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB246317_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCVETTMNAHQILPKVLHKRTLGL
AB246335_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AB246336_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB246337_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB246338_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB362931_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB453984_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
AB453986_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AB453987_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB453988_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AB453989_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB480040_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARXMATTVNAHQILPKVLHKRTLGL
AB697487_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB697498_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AB937791_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AB937795_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKWTLGL
AB937797_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNARQTLPKVLHKRTLGL
AF043560_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF043580_HBx_P-A      AHLSLXGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AF090838_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AF090841_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF143302_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF297621_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF297622_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF297623_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AF297624_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AF297625_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AJ309369_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AJ309371_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AJ344115_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
AJ627226_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTIGL
AJ627227_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AM180624_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AM184125_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AM184126_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AM494718_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY034878_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTFARCMETTVNAHQILPKVLYKRTLGL
AY128092_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY152726_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
AY161138_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY161142_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRVTSARCMETTVNSHQVLPKVLYKWTLGL
AY233274_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233275_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233276_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAQQILPKVLHKRTLGL
AY233278_HBx_P-A      AHLSLRGLPVCAFTSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233279_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233280_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233281_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQIPPKVLHKRTLGL
AY233282_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233283_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233285_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233286_HBx_P-A      AHLSLRGLPVSAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY233288_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETIVNAHQILPKVLHKRTLGL
AY233290_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTFGL
AY373428_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY373429_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AY373432_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
AY738139_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCVETTVNAHQILPKVLHKRTLGL
AY738140_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCVETTVNAHQILPKVLHKRTLGL
AY738141_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCVETTVNAHQILPKVLHKRTLGL
AY738142_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCVETTVNAHQILPKVLHKRTPGL
AY862868_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY902775_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY903452_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934763_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934764_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934765_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AY934766_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
AY934767_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934769_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934770_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934771_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934772_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934773_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
AY934774_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
DQ020002_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMEATVNAHQILPKVLHKRTLGL
DQ020003_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
DQ298161_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
DQ298162_HBx_P-A      AHLSLRGLPVCAFSSAGPCARRFTSARCMETTVNAHQILPKVLHKRTLGL
DQ298163_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
DQ315784_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQVLPKVLHKRTLGL
DQ315785_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
DQ315786_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
DQ788728_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EF103278_HBx_P-A      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EF208113_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQIPPKVLHKRTLGL
EU054331_HBx_C-A      AHLSFHCLPVCAFSSDGPCALRFTSARCMATTVNDHQMLRKLLHKRAVGL
EU366129_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
EU414133_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLQKRTLGL
EU594385_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU594387_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU747320_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMENTVNAHQILPKVLHKRTLGL
EU859900_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKKTLGL
EU859901_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859903_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859906_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859917_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859927_HBx_P-A      AHLSLRGFPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859932_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859934_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859938_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859941_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859944_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
EU859948_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQLLPKVLHKRTLGL
EU859949_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQLLPKVLHKRTLGL
EU859952_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ349224_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQLLPKVLHKRTLGL
FJ349296_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
FJ692554_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAYQILPKVLHKRTLGL
FJ692557_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692558_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FJ692559_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692561_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FJ692562_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLYKRTLGL
FJ692563_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLRL
FJ692564_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692566_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
FJ692567_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692570_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
FJ692571_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
FJ692572_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FJ692573_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692574_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692575_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
FJ692576_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692577_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNTHQILPKVLHKRTLGL
FJ692587_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692590_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETAVNAHQILPKVLHKRTLGL
FJ692592_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692593_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
FJ692595_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FJ692597_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
FJ692598_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLXKRTLGL
FJ692599_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692601_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692602_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692603_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692605_HBx_P-A      AHLSLRGLPECAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692606_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692607_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692608_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHWILPKVLYKRTLGL
FJ692609_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692610_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692612_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ692613_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FJ904411_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
FM199974_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
FM199975_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FM199976_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
FM199977_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FM199979_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FM199981_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545825_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545826_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLYKRTLGL
FN545828_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
FN545829_HBx_P-A      AHLSLRGLPVCAFTSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545830_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545831_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545832_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545833_HBx_P-A      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FN545834_HBx_P-A      AHLSLRGLPVCAFSXAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
FN545835_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545836_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545837_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
FN545838_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQSLPKVLHKRTLGL
FN545839_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
GQ161813_HBx_P-A      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ184323_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ184324_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ331046_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHLILPKVLHKRTLGL
GQ477462_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
GQ477463_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477465_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477466_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
GQ477469_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHRILPKVLYKRTLGL
GQ477472_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
GQ477473_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
GQ477474_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477475_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
GQ477478_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
GQ477479_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ477480_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477486_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
GQ477487_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477488_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477490_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477494_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477498_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477499_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477500_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ477502_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GU563545_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GU563546_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GU563547_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
GU563550_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GU563551_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARYMETTVNAHQILPKVLHKRTLGL
GU563557_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GU563562_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
HM011485_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARYMETTVNAHQILPKVLXKRTLGL
HM535200_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHPILPKVLHKRTLGL
HM535205_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
JN182318_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JN182321_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNTHQILPKVLHKRTLGL
JN182322_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JN182323_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JN182324_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JN182325_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JN182330_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707299_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707306_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRLTSARCMETTVNAHQILPKVLHKRTLGL
JQ707309_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707317_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707329_HBx_P-A      AHLSLRGLPVCALSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707335_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707340_HBx_P-A      AHLSLRGLPVCAFSSAGPCALHFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707348_HBx_P-A      AHLSLRGLPVRAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707351_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707353_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707362_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707368_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
JQ707371_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707374_HBx_P-A      AHLSLRGLPVCAFSSAGQCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707376_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707380_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707383_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707397_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707400_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707403_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707405_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707411_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAQQILPKVLHKRTLGL
JQ707414_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707418_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707532_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707535_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707537_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707543_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707551_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707560_HBx_P-A      AHLSLRGLPVCAFSSTGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707568_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707581_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHKILPKVLHKRTLGL
JQ707582_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707589_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707592_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707604_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707611_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707617_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRYTSARCMETTVNAHQILPKVLHKRTLGL
JQ707625_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707626_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707642_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JQ707659_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHTRTLGL
JQ707672_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JX154579_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JX154582_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JX310722_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
JX310723_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KC875251_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTVGL
KC875252_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KC875253_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KC875254_HBx_P-A      AHLSLRGLPDCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KC875255_HBx_P-A      AHLSLHGLPVCAFSSAGPCALRFTSARCMATTVNAHQVLPKVLYKRTLGL
KC875256_HBx_P-A      AHLSLHGLPVCAFSPAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
KC875257_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNARQVLPKVLHKRTLGL
KC875258_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
KC875259_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
KC875260_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KF214657_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KF214658_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KF214659_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KF214660_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KF214661_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHPVLPKVLHKRTLGL
KF214662_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KF214663_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KF214665_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQVLPKVLHKRTLGL
KF214666_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
KF922406_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KF922414_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KF922417_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KF922420_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KF922424_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETSVNAHQILPKVLHKRTLGL
KF922429_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KF922433_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KF922434_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLYKRTLGL
KF922435_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KF922437_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQSLPKVLHKRTLGL
KJ010776_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ843172_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ843173_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ843183_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ843184_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPTVLHKRTLGL
KJ843188_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ843215_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854685_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854686_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
KJ854687_HBx_P-A      AHLSLRGLPVCAFSSAGPCAVRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854688_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854689_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854690_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854691_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854692_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854694_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854695_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLXKRTLGL
KJ854696_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854699_HBx_P-A      AHFSLRSLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
KJ854700_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854701_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854703_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854704_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854705_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854707_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ854709_HBx_P-A      AHLSLRGLPVCAFSSGGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KM243029_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KM519452_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KM519454_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KM606737_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KM606748_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168422_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHWILPKVLYKRTLGL
KP168423_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168424_HBx_P-A      AHLSLRGLPVCAFSSAGPCALPFTSARCMETTVNAHQILPKVLHKRTLGL
KP168425_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLXL
KP168426_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168427_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
KP168428_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168429_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
KP168430_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168431_HBx_P-A      AHLSLRGLPXCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168432_HBx_P-A      AHLSLRGLPICAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168433_HBx_P-A      AHLSLRGLPICAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KP168434_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP168435_HBx_P-A      AHLSLRGLPVRSSSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KP718085_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP718086_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKXTLGL
KP718090_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP718092_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP718093_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP718094_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KP718102_HBx_P-A      AHLSLRGLPVCAFSSAGPCALHFTSARCMETTVNAHQILPKVLHKRTLGL
KP995108_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KR905425_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KR905426_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KR905427_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHPVLPKVLYKRTLGL
KR905429_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KR905430_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQVLPKVLHKRTLGL
KT151611_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTLNAHQVLPKVLHKRTLGL
KT151612_HBx_P-A      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
KT151613_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KT151614_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KT151615_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLXKRTLGL
KT151616_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KT151617_HBx_P-A      AHLSLRGLPVCAFSPXGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
KT151618_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
KT347087_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KT347088_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KT347091_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHRILPKVLHKRTLGL
KT749822_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KT749825_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KT749833_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KT749840_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETPVNAHQILPKVLHKRTLGL
KT749842_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU605532_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU605533_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU605534_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTGNAHQILPKVLHKRTLGL
KU605536_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KU605537_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
KU736918_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU736919_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KU736920_HBx_P-A      AHLSLXGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX276769_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX357643_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX357644_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHRSLPKVLHKRTLGL
KX357645_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX357647_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHWILPKVLHKRTLGL
KX357649_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTIGL
KX357650_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KX648547_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX648549_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KX827298_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVSAHQILPKVLHKRTLGL
L13994_HBx_P-A        AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
LC051141_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
LC462120_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTLNAHQILPKVLHKRTLGL
LT992441_HBx_P-A      AHLSLRGLPVCAFSSAGPCALHFTXARCMETTVNAHQILPKVLHKRTLGL
M57663_HBx_P-A        AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
MF772344_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF772345_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF772346_HBx_P-A      AHLSLRGLPVCAFTSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF772347_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF772348_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MF772350_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF772351_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHLILPKVLHKRTLGL
MF925362_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARQILPKVLHKRTLGL
MF925368_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MF925372_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
MF925373_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF925385_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MF925400_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MF925407_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MG877723_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH464808_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAXQILPKVLXKRTLGL
MH464809_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH464810_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH464811_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARXMETTVNAHQILPKVLHKRTLGL
MH464812_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH464813_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH464817_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQSLPKVLHKRTLGL
MH464825_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MH580627_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512456_HBx_P-A      AHLSLRGLPVGAFSPAGPCALRVTSARCMETTVNAHQSLPKVLHKRTLGL
MK512457_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512458_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512461_HBx_P-A      AHLSLRGLPVCAFSLAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512462_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLYKRTLGL
MK512463_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MK512464_HBx_P-A      AHLSLRGLPVCAFSPAGPCALRVTSARCMETTVNAHQVLPKVLYKRTLGL
MK512465_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512466_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVNAHQILPKVLHKRTLGL
MK512468_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512469_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MK512470_HBx_P-A      AHLSLRGLPVCAFSSAGSCALRFTSARCMATNVNAHQILPKVLHKRTLGL
MK512471_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512472_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512474_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MK512475_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MK512476_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MK512477_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILRKVLHKRTLGL
MN053840_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MN476101_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MN476102_HBx_P-A      AHLSLRGLPICAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MN544634_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MN585096_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHLILPKVLHKRTLGL
MN585097_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRILPKVLHKRTLGL
MT114170_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT210032_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MT210034_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT426088_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQVLPKVLHKRTLGL
MT426090_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT426092_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT426093_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT426097_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MT426098_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MT622525_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MW567976_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MZ043025_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043026_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043027_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043028_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MZ043029_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043030_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043031_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043032_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLHKRTLGL
MZ043033_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043034_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTLNAHQILPKVLHKRTLGL
MZ043035_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MZ043036_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
MZ043037_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043038_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQXLPKVLHKRTLGL
MZ043039_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAPQSLPKVLHKRTLGL
MZ043041_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQSLPKVLHKRTLGL
MZ043043_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043044_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043045_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLYKRTLGL
MZ043046_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043047_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQSLPKVLHKRTLGL
MZ043048_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043049_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHLILPKVLHKRTLGL
MZ043050_HBx_P-A      ANLSLRGLPVCAFSSAGPCALRFTSARYMETTVNAHQVLPKVLHKRTLGL
MZ043052_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLYKRTLGL
MZ043053_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043054_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHRSLPKVLHNRTLGL
MZ043055_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043056_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
MZ043057_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043058_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAHQILPKVLYKRTLGL
MZ043059_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLYKRTLGL
MZ043060_HBx_P-A      AHLSLRGLPVCAFSSAGPCALRF