HBVdb

Dataset for protein HBSP of genotype A

[Download (right click)] [Sequences] [Repertoires]

1612 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KJ854699_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB014370_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB064314_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLND
AB076678_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116076_HBSP_P-A      MPLSYQHFRKLLLLDAGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116078_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116081_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLND
AB116082_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116083_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116084_HBSP_P-A      MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116086_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
AB116087_HBSP_P-A      MPLSYQHFRKLLLLDDESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116088_HBSP_P-A      MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116089_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116090_HBSP_P-A      MPLSYPHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116091_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116092_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116093_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116094_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB126580_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB194950_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB194951_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB194952_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB205118_HBSP_P-A      MPLSYQHFRKQLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB241114_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB241115_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246317_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246336_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB362931_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453982_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453989_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB697493_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697506_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697511_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937795_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937798_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF043560_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090838_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNPND
AF090839_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF090841_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF143298_HBSP_P-A      MPLSYQQFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF143302_HBSP_P-A      MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
AF297622_HBSP_P-A      MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF297623_HBSP_P-A      MPLSYQHFRKLLLLDAETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF537371_HBSP_P-A      MPLSYQRFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDD
AF537372_HBSP_P-A      MPLSYQHFRKLLLLDVGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ309369_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ309370_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEEPPRLADADLNRRVAEDLNLGNLND
AJ344115_HBSP_P-A      MPLSYHHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627226_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627227_HBSP_P-A      MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627228_HBSP_P-A      MPLSYQFFRKLLLLDDETEVGPLEEELPRLADADLNRRVAEDLNLGNLND
AM180624_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGXLND
AM184125_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM282986_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
AM410963_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM494718_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY034878_HBSP_P-A      MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY152726_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161138_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161142_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEDSLRLADEDLNRRVAEDLNLGNLND
AY233274_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAGDLNLGNLND
AY233275_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233276_HBSP_P-A      MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233279_HBSP_P-A      MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233280_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY233281_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233284_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233285_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233286_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY233287_HBSP_P-A      MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233288_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233289_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373428_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373429_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLVEELPRLADEDLNRRVAEDLNLGNLND
AY738139_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY903452_HBSP_P-A      MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934763_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY934764_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934765_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934767_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934768_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ020002_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ020003_HBSP_P-A      MPLSYQHFRKLLLLDDVTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ298161_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298162_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADFNRRVTEDLDLGDPND
DQ298163_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298164_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298165_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPIEEELPRLADADPNRRVAEDLNLGDPND
DQ315784_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ315785_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ315786_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ788725_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNLND
EF103278_HBSP_P-A      MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU185787_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU304331_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADZDLNRRVAEDLNLGNLND
EU366129_HBSP_P-A      MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU414132_HBSP_P-A      MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNXND
EU594386_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594388_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU859912_HBSP_P-A      MPLSYQHFRKLLLVDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859934_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859944_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU859952_HBSP_P-A      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNLNE
EU859955_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349296_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692554_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FJ692558_HBSP_P-A      MPLSYQHFRKLLLLDDETVAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692559_HBSP_P-A      MPLSYQXFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGXLND
FJ692561_HBSP_P-A      MPLSYQHFRXLLLLDVEPEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692564_HBSP_P-A      MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692565_HBSP_P-A      MPLSYQHFRKLLLLDDEXEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692567_HBSP_P-A      MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNXND
FJ692570_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692571_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRHVAEDLNLGNLND
FJ692572_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692575_HBSP_P-A      MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692576_HBSP_P-A      MPLSYQHFRKLLLLEDDPEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692577_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692578_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692586_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEXLNRRVAEDLNLGNLND
FJ692587_HBSP_P-A      MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692590_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692592_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692593_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692595_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692596_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692597_HBSP_P-A      MPLSYQHFRKLLLLDXXSEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692599_HBSP_P-A      MPLSYRHFLKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692600_HBSP_P-A      MPLSYQHFRKLLLLDDXTEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692603_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEELNHRVAEDLNLGNLND
FJ692605_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692606_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692607_HBSP_P-A      MPLSYQHFRKLLLLDEETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692608_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692609_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692610_HBSP_P-A      MPLSYQHFRKLLLLDDEXEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692611_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEGLNRRVAEDLNLGNLND
FJ692612_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692613_HBSP_P-A      MPLSYQHFRRLLLLDDEIEAGPLEDELPRLADEDLNHRVAEDLNLGNLTD
FJ904411_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ904434_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FM199975_HBSP_P-A      MPLSXQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199976_HBSP_P-A      MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199977_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNRRVAEDLNLGNLND
FM199980_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199981_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRXVAEDLNLGNLND
FN545825_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEXLNLGNLND
FN545826_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545828_HBSP_P-A      MPLSYQHFRKLLLLDEGTQAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545829_HBSP_P-A      MPLSYQHFRKLLLLDEGTELGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545830_HBSP_P-A      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545831_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FN545833_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545834_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545835_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545836_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FN545837_HBSP_P-A      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545838_HBSP_P-A      MPLSYQHFRKLLLLDYGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FN545839_HBSP_P-A      MPLSYQHFRKLLLLXVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545840_HBSP_P-A      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ331046_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
GQ331047_HBSP_P-A      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNPNE
GQ477462_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLHLGDLND
GQ477463_HBSP_P-A      MPLSYQLFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477465_HBSP_P-A      MPLSYQHFRKLLFVDDGSEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477468_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477469_HBSP_P-A      MPLSYQSFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477472_HBSP_P-A      MPLSYQYFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477473_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477475_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477476_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477477_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
GQ477478_HBSP_P-A      MPLSYQHFRKILLLDHGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477480_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477484_HBSP_P-A      MPLSYQHFRKLLLLDDSTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477488_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477491_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477493_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477494_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477495_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477496_HBSP_P-A      MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477497_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTD
GQ477498_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477499_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADANLNRRVAEDLNLGNLND
GQ477501_HBSP_P-A      MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477502_HBSP_P-A      MPLSYQHFRKLLLLDHETEAGPLEEELPRLADADLNRRVAEDLNLGDLND
GQ477504_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563547_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563551_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
HE576988_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HE576989_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HM011485_HBSP_P-A      MPLSYQHFRKLLLLDDETKAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM363612_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM535205_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439720_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439721_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439725_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439739_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439747_HBSP_P-A      MPLSYRHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439748_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDPNLGNLND
JF439752_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439767_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439819_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439820_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439821_HBSP_P-A      MPLSYQHFRKLLLLDDGTDAGSLKEELPRLADADLNRRVAEDLXLGNLND
JF439822_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
JF439823_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439824_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439832_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439836_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439838_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439842_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439843_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439846_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439849_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439854_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439864_HBSP_P-A      MPLSYQHSRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439865_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439868_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439886_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439887_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439889_HBSP_P-A      MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439911_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439914_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439917_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439919_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439923_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439925_HBSP_P-A      MLLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439926_HBSP_P-A      MSLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439928_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439929_HBSP_P-A      MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439931_HBSP_P-A      MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439932_HBSP_P-A      MPLSYQHFRNVLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439937_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439938_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439942_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439943_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439951_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439954_HBSP_P-A      MPLSYQHFRILLLLDDETEAGPLEEELPRLADADLNRRVAEDLDLGNLND
JF439963_HBSP_P-A      MPLSYQHFRKLLLLYDETEAGPLEEELPRLADADLNRRVAEDLNLGNFND
JF439965_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439966_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADPNRRVAEDLNLGNLND
JF439967_HBSP_P-A      MPLSYQHFRKLLLLDDETEARPLQQELPRLADADLNRRVAEDLNLGNLND
JF439969_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLHD
JF439970_HBSP_P-A      MPLSYQHFRKLLLLGDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439971_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEGLPRLADADLNRRVAEDLNLGNLND
JF439975_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLND
JF439979_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439982_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNPND
JF439984_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439987_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440018_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JN182318_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182334_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAVDLNLGNLND
JQ023660_HBSP_P-A      RPLSYQHFRKLLLLDDETEASPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ023661_HBSP_P-A      RPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
JQ023662_HBSP_P-A      RPLSYQHFRKLLLFDDETEAGPLKEELPRLADENLNRRVAKDLNLGNLND
JQ023663_HBSP_P-A      RPLSYQHFRKLLLFDDETEAGPLKEELPRLANENLNRRVAKNLNLGNLND
JQ707299_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707300_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRIAEDLNLGNLND
JQ707305_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707306_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707308_HBSP_P-A      MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707324_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707325_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707327_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707329_HBSP_P-A      MPLSYQNFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707339_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707345_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707346_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707347_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707368_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLND
JQ707395_HBSP_P-A      MPLSYQHFRKLLLLDDGTAAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707397_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707398_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707401_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707407_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707419_HBSP_P-A      MPLSYQHFRKLLLLDDGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707532_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707536_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707537_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707549_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707550_HBSP_P-A      MPLSYQHFRKLLLLDDGIEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707575_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707577_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707581_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707582_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707589_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707599_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707635_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRHADADLNRRVAEDLNLGNLND
JQ707674_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX096952_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KC875259_HBSP_P-A      MPLSYQHFRKLVLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875260_HBSP_P-A      MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF214659_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214660_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214662_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214666_HBSP_P-A      MPLSYQHFRKLLLLDDE--VGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF779210_HBSP_P-A      MPLSYQHFRSLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779213_HBSP_P-A      MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLND
KF779221_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADSDRRVAEDLNLGNLND
KF779232_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779239_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLND
KF779261_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779264_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779265_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAYLNRRVAEDLNLGNLND
KF779268_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADASLNRRVAEDLNLGNLND
KF779270_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779272_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779276_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779280_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779284_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAVSHINRRVAEDLNLGNLND
KF779293_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779295_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779297_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLYRRVAEDLNLGNLND
KF779308_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLND
KF779329_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVPEDLNLGNLND
KF779332_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF779334_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAAPYRRVAEDLNLGNLND
KF779360_HBSP_P-A      MLLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779384_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF922406_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922407_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF922414_HBSP_P-A      MPLSYHHFRKLLLLDDEAETGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922415_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922429_HBSP_P-A      MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922431_HBSP_P-A      MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922433_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922434_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922435_HBSP_P-A      MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ843172_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843183_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ843216_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843217_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLND
KJ854685_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854689_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854701_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
KJ854703_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854704_HBSP_P-A      MPLSYQHFRKLLLLDEETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854706_HBSP_P-A      MPLSYQRFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854709_HBSP_P-A      MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606737_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168422_HBSP_P-A      MPLSYQHFRKLLLLDXETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168424_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168426_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168427_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168428_HBSP_P-A      MPLSYQHFRKLLLLDVATEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168429_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168431_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168433_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP168434_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168435_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLND
KP718095_HBSP_P-A      MPLSYQHFRKLLLLDDEAEAGPLEEEPPRLADEDLNRRVAEDLNLGNLND
KP718102_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELXRLADADLNRRVAEDLNLGNLND
KR905425_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905426_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905427_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KR905429_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR905430_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151611_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151612_HBSP_P-A      MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151613_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366467_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT749822_HBSP_P-A      MPLSYQHFRNVLLLDTGTEAGLLEEELPRLADEDLNRRVAEDLNLGNLND
KT749833_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749834_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLND
KT749839_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEQELPRLADADLNRRVAEDLNLGNLND
KU605536_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX276769_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLND
KX357643_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357646_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648547_HBSP_P-A      MPLSYQHFRKLLLLDDEAAAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648548_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648549_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX827297_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLND
LC051141_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
LC462120_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
LT992440_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
LT992441_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGNPND
LT992448_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGNPND
M57663_HBSP_P-A        MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772344_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772345_HBSP_P-A      MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772346_HBSP_P-A      MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772347_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772353_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925362_HBSP_P-A      MPLSYQHFRKLLLLDDEAKAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925373_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464808_HBSP_P-A      MPLSYQHFXKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464809_HBSP_P-A      MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464810_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464811_HBSP_P-A      MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464816_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464820_HBSP_P-A      MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464825_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464829_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580627_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512460_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLANKNLNRRVAKDLNLGNLND
MK512462_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512463_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADKDLNRRVAENLNLGNLND
MK512464_HBSP_P-A      MPLSYQHFRKLLFLDDETEAGPLEEELPRLADEDFNRRVAEDLNLGNLND
MK512466_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512469_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512474_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRPADEDLNRRVAEDLNLGNLND
MK512475_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512477_HBSP_P-A      MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN053840_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN476102_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN507849_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MN544634_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN585096_HBSP_P-A      MPLSYQHFRKLLLLDDGDMAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
MN585097_HBSP_P-A      MPLSYQHFRKLLLLDDGDMAGPLEEELPRLADEDLHRRVAEDLNLGNPND
MT114170_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT210032_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT210034_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426090_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426091_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426092_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426096_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAGADLNRRVAEDLNLGNLND
MT622525_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567968_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567969_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567972_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567973_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567975_HBSP_P-A      MPLSYQHFRKILLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567976_HBSP_P-A      MPLSYQHFRKLLLLEVGAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW847938_HBSP_P-A      MPLSYQHFRKLLLLDDETGAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999475_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPPLADADLNRRVAEDLNLGNLND
MW999482_HBSP_P-A      MPLSYQHFRKLLLLDNETEAGSLEEELPRLADEDLNRRVAEDLNLGNLND
MW999487_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999503_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLANEDLNRRVAEDLNLGNLND
MW999506_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
MW999510_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLANEDLNRRVAKDLNLGNLND
MW999511_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999517_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999519_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
MW999546_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999598_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNX
MW999601_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNPND
MZ043027_HBSP_P-A      MPLSYQHFLKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043031_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043032_HBSP_P-A      MPLSYQHFRKLLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043033_HBSP_P-A      MPLSYQHFRKLLLLEVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043034_HBSP_P-A      MPLSYQHFMKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043035_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADPDLNRRVAEDLDLGNLDD
MZ043037_HBSP_P-A      MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
MZ043038_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MZ043039_HBSP_P-A      MPLSYQHFRRLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043041_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043043_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043044_HBSP_P-A      MPLSYQHFRKLLLLDD-GDAGPLEEXLPRLADADLNRRVAEDLNLGNLND
MZ043045_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043048_HBSP_P-A      MPLSYQHFRKLLLLDVGPEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043049_HBSP_P-A      MPLSYQHFRKLLLLETGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043051_HBSP_P-A      MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043052_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043053_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043056_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043058_HBSP_P-A      MPLSYQHFRNVLLLDNGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043059_HBSP_P-A      MPLSYQHFRKLLLLEVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043060_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043063_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVXEDLNLGNLND
MZ043064_HBSP_P-A      MPLSYQHFRKLLLLEAGDEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043065_HBSP_P-A      MPLSYQSFRKLLLLDHGADAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043067_HBSP_P-A      MPLSYQHFRKLLLLDDGAETGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043068_HBSP_P-A      MPLSYQHFRKLLLLDHDTEAGPLEEELPRLADADLNRRVAEDLNLGTLND
MZ043070_HBSP_P-A      MPLSYQHFRKLLLLDDGTTAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043071_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043073_HBSP_P-A      MPLSYQHFRKLLLLDNDPEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043074_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043076_HBSP_P-A      MPLSYQHFLKLLLLDDE--AGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043080_HBSP_P-A      MPLSYQHFRKLLLLDLETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043081_HBSP_P-A      MPLSYQHFRKLLLLDHGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043082_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTD
MZ043085_HBSP_P-A      MPLSYQHFRKLLLLDHGTDAGPLEEELPRLADADLNRRVADDLNLGTLND
MZ043086_HBSP_P-A      MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043087_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043089_HBSP_P-A      MPLSYQHFRKLLLLDVETEVGSLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043090_HBSP_P-A      MPLSYQHFRKLLLLDNGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043092_HBSP_P-A      MPLSYQHFRXLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043093_HBSP_P-A      MPLSYQHFRKLLLLDDG--AGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043094_HBSP_P-A      MPLSYPRFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043095_HBSP_P-A      MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043096_HBSP_P-A      MPLSYQHFLKLLLLDHESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ093431_HBSP_P-A      MPLSYQHFRRLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK143477_HBSP_P-A      MPLSYQHFRKLLLLED--EAGPLEEELPRLADADLNRRVAEDLNLGDLND
OK143478_HBSP_P-A      MPLSYQHFRKLLLLDDE--LGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143482_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143483_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143492_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143495_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLANADLNRRVAEDLNLGNLND
OK143498_HBSP_P-A      MPLSYQHFRKLLLLDN--DAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK998526_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLND
OM304326_HBSP_P-A      MPLSYQHFRKLLLLDVGTEEGPLEEELPRLADADLNRRVAEDLHLGDLND
ON585698_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON585700_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
ON854558_HBSP_P-A      MPLSYQHFRKLLWLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854559_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854560_HBSP_P-A      MSLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854562_HBSP_P-A      MPLSYQHFRKLLLLDVEAEAGPLEEELPRLADQDLNRRVAEDLNLGNLND
ON854563_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854564_HBSP_P-A      MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854565_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
ON854567_HBSP_P-A      MPLSYQHFRKLLLLDDGAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854568_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854569_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854570_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854571_HBSP_P-A      MPLSYQHFRKLLLLDDEAEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854579_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854581_HBSP_P-A      MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854584_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854590_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
ON854594_HBSP_P-A      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
V00866_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X02763_HBSP_C-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLHRRVAEDLNLGNLND
Z72478_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU747320_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ184323_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707553_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707556_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707558_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707559_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707572_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779365_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749825_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749826_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749842_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY886219_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043025_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
ON854561_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854573_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854574_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854580_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854583_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854585_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854589_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854592_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854593_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116079_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116080_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB222707_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB246337_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB246338_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB300366_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB300367_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453979_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453980_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453981_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453983_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453984_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480036_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480038_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480039_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480040_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480041_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB549213_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697487_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697488_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697489_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697491_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697492_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697495_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697496_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697497_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697498_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697499_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697501_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697503_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697504_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697505_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697507_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697508_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697509_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697512_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775198_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775199_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775200_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775201_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937792_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937793_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937794_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF043580_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF297624_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ012207_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM295795_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM295797_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY128092_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY862867_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY862868_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EF208113_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU086721_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU414133_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594383_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594384_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594385_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594387_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594389_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594390_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594391_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594392_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594393_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594394_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594395_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859899_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859900_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859901_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859902_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859903_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859904_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859905_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859906_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859907_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859908_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859909_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859910_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859911_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859913_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859914_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859915_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859916_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859917_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859918_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859919_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859920_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859921_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859922_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859923_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859924_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859925_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859926_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859927_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859928_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859929_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859930_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859931_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859932_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859933_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859935_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859936_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859937_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859939_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859940_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859941_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859942_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859943_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859945_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859946_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859947_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859948_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859949_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859950_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859953_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349222_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349224_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ414522_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477461_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477467_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477470_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477479_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477482_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477487_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477490_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477503_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563546_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563553_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563554_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563555_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563557_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563558_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563562_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ687529_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707534_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707541_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707544_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707546_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707547_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707548_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707552_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707555_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707557_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707560_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707562_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707563_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707564_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707565_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707566_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707567_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707568_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707570_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707573_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707609_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707610_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707611_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707612_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707613_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707614_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707615_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707616_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707617_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707618_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707619_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707620_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707621_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707622_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707623_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707624_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707625_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707626_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707627_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707628_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707629_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707630_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707631_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707632_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707633_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707634_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707636_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707637_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX096953_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310721_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310722_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310723_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310724_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310725_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779211_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779227_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779231_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779243_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779244_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779245_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779246_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779247_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779248_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779249_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779251_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779252_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779253_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779254_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779255_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779256_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779257_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779258_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779259_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779262_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779271_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779273_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779274_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779275_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779277_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779279_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779281_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779282_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779286_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779287_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779290_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779291_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779294_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779299_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779304_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779305_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779306_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779307_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779309_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779310_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779313_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779314_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779315_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779316_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779317_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779319_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779320_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779321_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779322_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779323_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779324_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779325_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779326_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779328_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779330_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779333_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779335_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779336_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779338_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779339_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779342_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779346_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779347_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779350_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779352_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779355_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779362_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779363_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779364_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779366_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779368_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779369_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779370_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779371_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779372_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779373_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779378_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779379_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779383_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779385_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779386_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ586809_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843166_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843173_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843184_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843188_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843192_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843214_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843215_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854708_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854710_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606742_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606746_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606749_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP274927_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP274928_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718087_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718088_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718090_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718091_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718092_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718093_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718094_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718096_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718097_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718098_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718099_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718100_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718101_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749824_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749829_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749830_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749831_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749832_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749835_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749836_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749837_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749840_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749843_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749844_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749850_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KU605532_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827293_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827298_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY003230_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY382410_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
L13994_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC074724_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311241_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311242_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311243_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC430617_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC458430_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC458431_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC517161_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592168_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592169_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592170_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677081_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677082_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677083_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MH932713_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426093_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426094_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426095_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426097_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999477_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999478_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999479_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999480_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999481_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999484_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999486_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999488_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999489_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999490_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999491_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999492_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999493_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999495_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999496_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999497_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999498_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999499_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999500_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999501_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999502_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999504_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999505_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999507_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999508_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999509_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999513_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999514_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999515_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999516_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999518_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999520_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999521_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999522_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999524_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999527_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999528_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999529_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999530_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999531_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999532_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999535_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999537_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999539_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999540_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999541_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999542_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999545_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999547_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999548_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999549_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999550_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999551_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999554_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999556_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999557_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999558_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999559_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999560_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999562_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999563_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999564_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999565_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999566_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999571_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999572_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999573_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999574_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999577_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999578_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999579_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999580_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999583_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999584_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999586_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999587_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999589_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999590_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999592_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999596_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999599_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999600_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043026_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043036_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043040_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043042_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043047_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043055_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043069_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043072_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043084_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK106253_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X70185_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
Z35717_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859898_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLND
AF536524_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HM363613_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246335_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB453986_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090842_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY161143_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY161144_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373432_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214657_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214661_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214663_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214665_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ194506_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM243029_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366469_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366471_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925361_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925372_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426088_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999476_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999485_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999523_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999525_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999543_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999544_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999561_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999570_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999585_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999588_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF297621_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233290_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357647_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK274310_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB453987_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937791_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937796_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF297625_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233278_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233282_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233283_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934769_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934770_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934771_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934774_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU410082_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692557_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692562_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692563_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692574_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199974_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199978_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199979_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563545_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563548_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM535200_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154579_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154580_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154581_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154582_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922424_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922425_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922426_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922427_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922428_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854693_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854695_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854700_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854707_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM519452_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM519453_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM606748_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168423_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168425_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718085_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718086_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347088_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347091_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347092_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605535_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736920_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357642_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357645_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357650_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF772351_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925368_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464812_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464815_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464828_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512456_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512457_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512458_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512459_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512461_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512465_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512467_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512470_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512472_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512473_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999553_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043088_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON585702_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854582_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999526_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999536_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999552_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999575_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859938_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477466_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MG877723_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MG877724_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MG877725_HBSP_P-A      MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718089_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749846_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749847_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749849_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ184324_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707531_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707533_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707535_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707538_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707539_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707540_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707542_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707543_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707545_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707561_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707569_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707571_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854686_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854691_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854692_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854694_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854696_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854702_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854705_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357640_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512471_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512476_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999494_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999555_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999567_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999576_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999591_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999595_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043030_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090840_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY902775_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477464_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707303_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707304_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707307_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707309_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707310_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707312_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707315_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707318_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707321_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707323_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707332_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707334_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707336_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707338_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707343_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707371_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707372_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707373_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707374_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707375_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707376_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707377_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707378_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707379_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707380_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707381_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707382_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707383_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707384_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707385_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707386_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707387_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707388_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707389_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707390_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707391_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707392_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707393_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707394_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707396_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707399_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779234_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779260_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779263_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779269_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779283_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779298_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779312_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779331_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779337_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779344_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779345_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779348_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779349_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779351_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779354_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779356_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779358_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779359_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779361_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779374_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779375_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827294_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827295_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827296_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772350_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043083_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X51970_HBSP_P-A        MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
DQ788728_HBSP_P-A      MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
AJ309371_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM184126_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU054331_HBSP_C-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY707087_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
ON093162_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
EU859951_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859954_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859956_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563550_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439833_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439834_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439835_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439837_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439839_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439841_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439844_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439845_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439847_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439848_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439851_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439852_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439853_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439857_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439859_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439867_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707595_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707638_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707639_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707640_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707641_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707642_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707643_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707644_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707645_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707646_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707647_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707648_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707649_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707650_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707651_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707652_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707653_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707654_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707655_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707656_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707658_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707659_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707661_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707662_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707663_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707664_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707665_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707667_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707669_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707670_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707672_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707675_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707676_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707681_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM519454_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161139_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779367_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426098_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426099_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY934773_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854557_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854578_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854586_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934766_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692566_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875251_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875252_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875253_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875254_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875255_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875256_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214658_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854687_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854688_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854690_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168430_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168432_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925385_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925407_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999568_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999569_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY738140_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738141_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738142_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738143_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ161813_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736918_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736919_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU185789_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749838_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ707574_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707579_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707580_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707584_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707587_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707588_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707591_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707593_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707596_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707600_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707601_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707602_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707605_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ692579_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692580_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692581_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692582_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692583_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692584_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692585_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854698_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692591_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357644_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357649_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925400_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854566_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692598_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692601_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692602_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692604_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
MW999533_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707551_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779381_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043075_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477500_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779266_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843182_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843186_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843218_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043062_HBSP_P-A      MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772348_HBSP_P-A      MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
KP995108_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043054_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043077_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439722_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439729_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439730_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439742_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439743_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439745_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439746_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439723_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439724_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439732_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439733_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439735_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439736_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439737_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439738_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439751_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439896_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439897_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439898_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439899_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439900_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439901_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439902_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439903_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439904_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439905_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439906_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439907_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439908_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439909_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439910_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439727_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439728_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439740_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439741_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439750_HBSP_P-A      MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439753_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439754_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439755_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439756_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439757_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439758_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439759_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439761_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439762_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439763_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439764_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439765_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439766_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439981_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779238_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779240_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999538_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999582_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439768_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439769_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439770_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439771_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439772_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439773_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439774_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439775_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439777_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439778_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440016_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440020_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439827_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439825_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439826_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439828_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439829_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439830_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439831_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439840_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439850_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439855_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439858_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439860_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439861_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439862_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439866_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707576_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707585_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707586_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707590_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707592_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707597_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707608_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439856_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439890_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439888_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439891_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439892_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439893_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439894_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439895_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439912_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439913_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439915_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439916_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439918_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439920_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439921_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439922_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439924_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439927_HBSP_P-A      MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439930_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439933_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439939_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439941_HBSP_P-A      MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439934_HBSP_P-A      MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439936_HBSP_P-A      MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439940_HBSP_P-A      MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439935_HBSP_P-A      MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439944_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439945_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439946_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439947_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439948_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439949_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439950_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439952_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439953_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439955_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439956_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439957_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439958_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439959_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439960_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439961_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439962_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439968_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439972_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439973_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439974_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439977_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439978_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439980_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439983_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439986_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439989_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439991_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439992_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439993_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439976_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLND
JF439985_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439988_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439990_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JN182319_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182320_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182321_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182322_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182323_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182324_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182325_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182326_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182327_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182328_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182329_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182330_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182332_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182333_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ707301_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707302_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707311_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707316_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707319_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707320_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707333_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707337_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707341_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707342_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707313_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707314_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707317_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707322_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707328_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707330_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707331_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707326_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707344_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043057_HBSP_P-A      MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707349_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707350_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707352_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707353_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707355_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707356_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707358_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707359_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707360_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707363_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707365_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707366_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707369_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707370_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707348_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707351_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707354_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707357_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707361_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707362_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707364_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707367_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707400_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707402_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707403_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707404_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707405_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707406_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707409_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707410_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707411_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707412_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707413_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707414_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707416_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707417_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707418_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707420_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707408_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707415_HBSP_P-A      MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707554_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043078_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707578_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707583_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707603_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707604_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707606_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707594_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707598_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707607_HBSP_P-A      MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779215_HBSP_P-A      MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLND
MZ043061_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779311_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLND
KF922408_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922409_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010776_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010777_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010778_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922416_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922417_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922418_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922419_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922420_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922421_HBSP_P-A      MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922430_HBSP_P-A      MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347087_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922436_HBSP_P-A      MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922437_HBSP_P-A      MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854697_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN476101_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP274925_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLND
MZ043050_HBSP_P-A      MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KU605533_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605534_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366466_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905431_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366468_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366470_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151617_HBSP_P-A      MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151614_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151615_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151616_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151618_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605537_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605538_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605539_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464813_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464814_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464818_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464819_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464821_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464822_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464824_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464826_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464827_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464830_HBSP_P-A      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580639_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580642_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580643_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999483_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999534_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999597_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999581_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999594_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999593_HBSP_P-A      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043097_HBSP_P-A      MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143484_HBSP_P-A      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADADLNRRVAEDLNLGNLND
ON854587_HBSP_P-A      MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
                         **       : .        : :     *     : :     :     

KJ854699_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB014370_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
AB064314_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB076678_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AB116076_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB116078_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB116081_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB116082_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116083_HBSP_P-A      PQQPARDPAKPARVLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
AB116084_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116086_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
AB116087_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
AB116088_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116089_HBSP_P-A      QQQPARDPAKPARLLLEATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116090_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116091_HBSP_P-A      PQQPAREPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116092_HBSP_P-A      QQQPARDPAKPARLLLKGTLCFPHVAVQNLRMEIAPVFPSHHLGVSQNSY
AB116093_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB116094_HBSP_P-A      PQQPAREPAEPARLLLKATLRFPHVAVQNLRVEIAPVFPSHHLGLSQNTY
AB126580_HBSP_P-A      QQQPVRDHARPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB194950_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSQNTY
AB194951_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
AB194952_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
AB205118_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB241114_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB241115_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB246317_HBSP_P-A      PQPPARDPAGPAQLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSQNTY
AB246336_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB362931_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453982_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453989_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
AB697493_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697506_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697511_HBSP_P-A      QQQPVRDHAKPARLLLKATLCYPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB937795_HBSP_P-A      PQQPARDPAKPARLLLKATLXFPHVAVQNLRMEIAPVFPSHHLGLSQNXY
AB937798_HBSP_P-A      QQQPVRDHAKPARLLLEATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF043560_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
AF090838_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
AF090839_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHRPGLSQNTY
AF090841_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
AF143298_HBSP_P-A      QQQPVRDHAKPARLLLKATLCCPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF143302_HBSP_P-A      QQQPVRDRAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF297622_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF297623_HBSP_P-A      PQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AF537371_HBSP_P-A      QQQPVRNHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF537372_HBSP_P-A      QRQPVRDHAKPARLLLKATLRFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
AJ309369_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
AJ309370_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
AJ344115_HBSP_P-A      QQQPVRDHAKPARFLLAANLCFPHVAVQNLRMEIAPVFPSHRLGLSQATY
AJ627226_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AJ627227_HBSP_P-A      QQQPVRXHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AJ627228_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AM180624_HBSP_P-A      PXPPVRDPAEPARLLHKATLCFPHVAVQNLRTEIALVFPSHHPGLSQNTY
AM184125_HBSP_P-A      PQPPVRDPAEPARLLHKATLCFPHVAVQNLRTEIALVFPSHHPGLSQNTY
AM282986_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
AM410963_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AM494718_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AY034878_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY152726_HBSP_P-A      QQQQVRDHAKPARLLLKATLRCPHVAVQNLRMEIAPVFPSHRLGLSQNTY
AY161138_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY161142_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233274_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233275_HBSP_P-A      LQQRVRDLARPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233276_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233279_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233280_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
AY233281_HBSP_P-A      LQQRVRDLARPARLLLKTTLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233284_HBSP_P-A      LQQRVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233285_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233286_HBSP_P-A      QQQPVRGHAKPARLLLKATLCFPHVAVQHLRMEIAPVFPSHRPGLSQNTY
AY233287_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233288_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AY233289_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AY373428_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY373429_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY738139_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY903452_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934763_HBSP_P-A      PQQPVRGLAEAARLLLKATLCFPHVAVQNLRTEIAPVFPSHHHGLSENTY
AY934764_HBSP_P-A      PQQPARDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLSQNTY
AY934765_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQDTY
AY934767_HBSP_P-A      PQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934768_HBSP_P-A      PQQPVLDPAKPARLLLKATLWFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
DQ020002_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
DQ020003_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
DQ298161_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFHHVAVQNLRMEIAHVFPSHRPGLSQNTY
DQ298162_HBSP_P-A      QQLPVRDHAKPARLLLKATLCFHHVAVQNLRMEIAHVFPSHRPGLSQNTY
DQ298163_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPPVAVQNLRMEIAHVFPSHRPGLSQNTY
DQ298164_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPPVAVRNLRMEIAHVFPSHRPGLSQNTY
DQ298165_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPPVAVQNLRMEIAHVFPSHRPGLSQNTY
DQ315784_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
DQ315785_HBSP_P-A      QQQPARDLAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
DQ315786_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
DQ788725_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EF103278_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
EU185787_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRMEXAPVXXSHRPGLXQNTY
EU304331_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
EU366129_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
EU414132_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594386_HBSP_P-A      QQQPVRDHAKHARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594388_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859912_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859934_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMQIAPVFPSHRPGLSQNTY
EU859944_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMETAPVFPSHRPGLSQNTY
EU859952_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
EU859955_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
FJ349296_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
FJ692554_HBSP_P-A      PQPPVRDPAKAARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNSY
FJ692558_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPPVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692559_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692561_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
FJ692564_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
FJ692565_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
FJ692567_HBSP_P-A      QQPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
FJ692570_HBSP_P-A      PQQPVRDPAKPAXLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692571_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692572_HBSP_P-A      PQQPVRDPAKPARLLLKATLXFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
FJ692575_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNXY
FJ692576_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692577_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692578_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692586_HBSP_P-A      QQRPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
FJ692587_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
FJ692590_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
FJ692592_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692593_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692595_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIALVFPSHHPGLSQNTY
FJ692596_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692597_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692599_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FJ692600_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSXNTY
FJ692603_HBSP_P-A      PQPPVRDPAEPALLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692605_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692606_HBSP_P-A      PQPXVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692607_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FJ692608_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FJ692609_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLWTEIAPVFPSHHPGLSQNTY
FJ692610_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLWTEIAPVFPSHHPGLSQNTY
FJ692611_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FJ692612_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNXY
FJ692613_HBSP_P-A      PQPPVRDPAEPARLLLKATLYYPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ904411_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
FJ904434_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMETAPVFPSHRPGLSQNTY
FM199975_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199976_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199977_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199980_HBSP_P-A      PQQPVRDPAKPARLLLKAXLCFPHVAVQNLRLEIAPVFPSHHLGLSQNTY
FM199981_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FN545825_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FN545826_HBSP_P-A      PQRPVQDPAKPARLLLKATLCFPHVXVQNLRTEIAPVFPSHHLGLSQNTY
FN545828_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLSQNTY
FN545829_HBSP_P-A      PQPPVRDPAEPARLLLKATLCSPHVVVQNLRTEIAPVFPSHHPGLSQNTY
FN545830_HBSP_P-A      PRPPXRDPAEPARLLLKATLCFPPVVVQNLRTEIAPVFPSPHHGLSQNTY
FN545831_HBSP_P-A      PQPPARDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FN545833_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPPVVVQNLRTEIAPVFPSHXPGLSQNTY
FN545834_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPPVVVQNLRTEIAPVFPSHRPGLSQBXY
FN545835_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLSQNTY
FN545836_HBSP_P-A      PQLPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
FN545837_HBSP_P-A      PQQPARXPAKPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHLGLSQNTY
FN545838_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHLGLSQNTY
FN545839_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
FN545840_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
GQ331046_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
GQ331047_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
GQ477462_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477463_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477465_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477468_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477469_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
GQ477472_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRHGLSQNTY
GQ477473_HBSP_P-A      PQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477475_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477476_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477477_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
GQ477478_HBSP_P-A      QQQPVRDHAKPARFLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
GQ477480_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIALVFPSHRPGLSQNTY
GQ477484_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIALVFPSHRPGLSQNTY
GQ477488_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRHGLSQNTY
GQ477491_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477493_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477494_HBSP_P-A      QQQPVRGHAKPARLLLKATLCFPPVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477495_HBSP_P-A      QQQPVRDHAKPARLLLKTALCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
GQ477496_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
GQ477497_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477498_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPPVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477499_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477501_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHCPGLSQNTY
GQ477502_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMETAPVFPSHRPGLSQNSY
GQ477504_HBSP_P-A      QQQPVQDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563547_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
GU563551_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
HE576988_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRKEIAPVFPSHRPGLSQNTY
HE576989_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRKEIAPVFPSHCPGLSQNTY
HM011485_HBSP_P-A      PQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
HM363612_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
HM535205_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPPVAVQNLRMEIAPVFPSHHLGLSQNTY
JF439720_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439721_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439725_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439739_HBSP_P-A      PQQPVRDPAEPARLLLEATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439747_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439748_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439752_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439767_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JF439819_HBSP_P-A      QQQPERDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439820_HBSP_P-A      QQQPVRGHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439821_HBSP_P-A      QQQPVREHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439822_HBSP_P-A      QQQPVREHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439823_HBSP_P-A      QQQPERDHAKPARLLLKATLCFPHVAVQNLRMEVAPVSPSHRPGLSQNTY
JF439824_HBSP_P-A      QQQPVREHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439832_HBSP_P-A      RQQPVREHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439836_HBSP_P-A      QQQPVRDNAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439838_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPAFPSHRPGLSQNTY
JF439842_HBSP_P-A      QQQPVREHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439843_HBSP_P-A      QQQPVRDHAKPARLPLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439846_HBSP_P-A      QQQPVRDHAKPARLLLKATLYFPHVAVQNLRMEIAPVFPSHRPGLSQSTY
JF439849_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439854_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSRRPGLSQNTY
JF439864_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439865_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHIAVQNLRMEIAPVFPSHRPGLSQNTY
JF439868_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439886_HBSP_P-A      QQQPARDHAKPARLLLKATLRCPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439887_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439889_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439911_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNSY
JF439914_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSYRPGLSQNSY
JF439917_HBSP_P-A      QQQPVRDHAKPARLLPKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNSY
JF439919_HBSP_P-A      QQQPVRGHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRLGLSQNTY
JF439923_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
JF439925_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNSY
JF439926_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNSY
JF439928_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
JF439929_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
JF439931_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
JF439932_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
JF439937_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSRRPGLSQNTY
JF439938_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPIFPSHRPGLSQNTY
JF439942_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQSTY
JF439943_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439951_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAAQNLRMEIAPVFPSHRPGLSQNTY
JF439954_HBSP_P-A      RQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439963_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439965_HBSP_P-A      QQQPVRDHVKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439966_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439967_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439969_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439970_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439971_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439975_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439979_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRVEIAPVFPSHRPGLSQNTY
JF439982_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439984_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439987_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQDLRMEIAPVFPSHRPGLSQNTY
JF440018_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JN182318_HBSP_P-A      PQPPARDPARPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
JN182334_HBSP_P-A      PQPPARDPARPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
JQ023660_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ023661_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ023662_HBSP_P-A      PQQPVRDPCKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ023663_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ707299_HBSP_P-A      QQQPVRDHAKPARVLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707300_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707305_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707306_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707308_HBSP_P-A      QQQPVRDHAKPARVLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707324_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHCLGLSQNTY
JQ707325_HBSP_P-A      QQQPVRDHAKPARLMLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707327_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707329_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707339_HBSP_P-A      QQQPVREHAKPARVLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707345_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707346_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ707347_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707368_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707395_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHPPGLSQNTY
JQ707397_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JQ707398_HBSP_P-A      QQQPVRDHAKHARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707401_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPIFPSHRLGLSQNTY
JQ707407_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707419_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707532_HBSP_P-A      QKQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707536_HBSP_P-A      QKQPVRDHAKPARLLLKATLRFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707537_HBSP_P-A      QQQPVRDHAKPARLLLKATLRFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707549_HBSP_P-A      QQQPVRDHAKPARLLLKATLRFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707550_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707575_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVYPSHRPGLSQNSY
JQ707577_HBSP_P-A      PQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707581_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVYPSHHPGLSQNSY
JQ707582_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707589_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
JQ707599_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707635_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEMAPVFPSHRPGLSQNTY
JQ707674_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX096952_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KC875259_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875260_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHRPGLSQNTY
KF214659_HBSP_P-A      QQQPARDPAKPARLLLKETLCFPPVAVQNLWMEIAPVFPSHHLGLSQNTY
KF214660_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
KF214662_HBSP_P-A      QQQPARDPAKPARLLLKAPLCFPPVAVQNLRMETAPVFPSHHLGLSQNTY
KF214666_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KF779210_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779213_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779221_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779232_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPPVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779239_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779261_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVPNLRMEIAPVFPSHRLGLSQNTY
KF779264_HBSP_P-A      QQQPVRDHAKPARFLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779265_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779268_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779270_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779272_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFTSHRPGLSQNTY
KF779276_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779280_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779284_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779293_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVLPSHRLGLSQNTY
KF779295_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779297_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779308_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779329_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779332_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSENTY
KF779334_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779360_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779384_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF922406_HBSP_P-A      LQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922407_HBSP_P-A      LQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922414_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922415_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922429_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922431_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMETAPVFPSHHLGLSQNTY
KF922433_HBSP_P-A      PQQRVRDPAKPARLLLRTTLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922434_HBSP_P-A      PQQRVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922435_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ843172_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRLEIAPVFPSHRPGLSQNTY
KJ843183_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ843216_HBSP_P-A      QQQPIRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843217_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ854685_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
KJ854689_HBSP_P-A      PQQPVRDPARPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854701_HBSP_P-A      PQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
KJ854703_HBSP_P-A      PQQPVRDPARPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854704_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854706_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854709_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KM606737_HBSP_P-A      PQQPARDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
KP168422_HBSP_P-A      PQQPVRDLAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168424_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168426_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNXY
KP168427_HBSP_P-A      LQQPARDPAKPARLLLKATLCFPHVAVQNLRXEIAPVFPSHHLGLSQNXY
KP168428_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHAAVQNLRMEIAPVFPSHHLGLSQNTY
KP168429_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
KP168431_HBSP_P-A      PQQPARGPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168433_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168434_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KP168435_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRXEIALVFPSHHLGLSQNTY
KP718095_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718102_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KR905425_HBSP_P-A      QQQPARDPAKPARLLLKATLYFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KR905426_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KR905427_HBSP_P-A      QQQPALDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KR905429_HBSP_P-A      HQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGVSQNTY
KR905430_HBSP_P-A      QQQPAQDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT151611_HBSP_P-A      QQQPAQDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHXGLSQNTY
KT151612_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHXGLSQNTY
KT151613_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHXGLSQNTY
KT366467_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT749822_HBSP_P-A      QQQPVRDHAKLARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749833_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRKEIAPVFPSHRPGLSQNTY
KT749834_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749839_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KU605536_HBSP_P-A      QPQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX276769_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGXSXNTY
KX357643_HBSP_P-A      PQRPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357646_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
KX648547_HBSP_P-A      PQQPVRDPAKPARLLLKATLFFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX648548_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX648549_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
KX827297_HBSP_P-A      QQQPVRDHARPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC051141_HBSP_P-A      PQPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
LC462120_HBSP_P-A      PQPPVRDPAGPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
LT992440_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
LT992441_HBSP_P-A      QQRPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
LT992448_HBSP_P-A      PRPPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHHLGLSQNTY
M57663_HBSP_P-A        QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF772344_HBSP_P-A      QQQPVRAHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MF772345_HBSP_P-A      QQQPARDHARPAQLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MF772346_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MF772347_HBSP_P-A      QQQPVRDHAKPARLLLKATLQFPHVAVQNLRMEIAPVFPSRRLGLSQNTY
MF772353_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQDTY
MF925362_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925373_HBSP_P-A      PQPPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464808_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464809_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
MH464810_HBSP_P-A      PQQPVRDPAKPARLLLKAPLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464811_HBSP_P-A      PQQPVRDPAKPARXLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464816_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
MH464820_HBSP_P-A      QQQPVRDPAKPTRLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464825_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464829_HBSP_P-A      PQQPVRDPAKPARLLLKANLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH580627_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
MK512460_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512462_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512463_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512464_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
MK512466_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
MK512469_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512474_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512475_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512477_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MN053840_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MN476102_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MN507849_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MN544634_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
MN585096_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MN585097_HBSP_P-A      QQPPARDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MT114170_HBSP_P-A      PQQPARGPAKPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHLGLSQNTY
MT210032_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MT210034_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRXEIAPVFPSHHLGLSQNTY
MT426090_HBSP_P-A      PQQPVRDPAGPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
MT426091_HBSP_P-A      PQQPVRDPAGPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MT426092_HBSP_P-A      QQQPVRDPAKPARLPLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MT426096_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MT622525_HBSP_P-A      PRPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
MW567968_HBSP_P-A      LQQPVRGLAXAARLLLKATLCFPHVAVQNLRTEIAPVFPSHHHGLSENTX
MW567969_HBSP_P-A      PQQPVRGLAEAARLLLKATLCFPHVAVQNLRTETAPVFPSHRHGLSENTY
MW567972_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTX
MW567973_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
MW567975_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
MW567976_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
MW847938_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999475_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999482_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999487_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999503_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999506_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999510_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999511_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999517_HBSP_P-A      HQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999519_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999546_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999598_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999601_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHXPGLSQNTY
MZ043027_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHRPGLSQNTY
MZ043031_HBSP_P-A      QQQPVRDRAKPARLLLKATLCCPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043032_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043033_HBSP_P-A      QQQPXRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
MZ043034_HBSP_P-A      PQQPVRDPAEPARLLHKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
MZ043035_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043037_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
MZ043038_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043039_HBSP_P-A      QQRPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043041_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MZ043043_HBSP_P-A      QXQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043044_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHAAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043045_HBSP_P-A      QQQPVRDHAKPARLLHKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043048_HBSP_P-A      QQQPVRDRAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043049_HBSP_P-A      QQQPVRDHAKPARLLLETTLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043051_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043052_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043053_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVVVQNLRMEIAPVFPSHRLGLSQNTY
MZ043056_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MZ043058_HBSP_P-A      QQQPXRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
MZ043059_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
MZ043060_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNPY
MZ043063_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043064_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043065_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043067_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043068_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043070_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043071_HBSP_P-A      QQPPVRDHAKPARRLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043073_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043074_HBSP_P-A      QQQPVRDHAKPARLXLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043076_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043080_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MZ043081_HBSP_P-A      QQQPVRDHARPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043082_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043085_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043086_HBSP_P-A      PQRPARDPAKPARLLLTATLRFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MZ043087_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043089_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MZ043090_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043092_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
MZ043093_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVVVQNLWTEIAPVFPSHRPGLSQNTY
MZ043094_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043095_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043096_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNSY
MZ093431_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
OK143477_HBSP_P-A      QQQPVRDLAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
OK143478_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
OK143482_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
OK143483_HBSP_P-A      QQQPVRDHAKPARLLLKATLCLPHVAVQNLRMEIAPVFPSHRPGLSQNTY
OK143492_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
OK143495_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
OK143498_HBSP_P-A      QQQPVRDHAKPARLLLKATLRFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
OK998526_HBSP_P-A      QQQPVRDHAKPPRLLLEGTLCFPRVAVQNLRMEIAPVFPSHRPGLSQNTY
OM304326_HBSP_P-A      QQPPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
ON585698_HBSP_P-A      PQQPVRDPAKPARLLLKGTLCFPPVAVQNLRTEIAPVFPSHHLGLSQNTY
ON585700_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON854558_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSQNTY
ON854559_HBSP_P-A      PQPPARDPAEPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854560_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854562_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854563_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854564_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854565_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854567_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSQNTY
ON854568_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854569_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854570_HBSP_P-A      PQQPVRGPAGPARLLLKATLCFPHVAVQNLRTEIAPVFPCHHLGLSQNSY
ON854571_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSENTY
ON854579_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON854581_HBSP_P-A      PQQPARDPAGPARLLLKGTLCFPHVAVQNLRMEIALVFPSHHLGLSENTY
ON854584_HBSP_P-A      PQPPARDHAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHPGLSQNTY
ON854590_HBSP_P-A      PQQPARDPAKPARLLLKGTLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON854594_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRTEIALVFPSHHLGLSQNTY
V00866_HBSP_P-A        QQQPVRDHAKPARLLLKATLSFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
X02763_HBSP_C-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
Z72478_HBSP_P-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRLEIAPVFPSHRPGLSQNTY
EU747320_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
GQ184323_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707553_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707556_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707558_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707559_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707572_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
KF779365_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
KT749825_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
KT749826_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
KT749842_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
KY886219_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
MZ043025_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
ON854561_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854573_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854574_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854580_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854583_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854585_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854589_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854592_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854593_HBSP_P-A      PQPPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AB116079_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB116080_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB222707_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB246337_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB246338_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB300366_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB300367_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453979_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453980_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453981_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453983_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB453984_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB480036_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB480038_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB480039_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB480040_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB480041_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB549213_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697487_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697488_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697489_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697491_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697492_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697495_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697496_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697497_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697498_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697499_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697501_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697503_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697504_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697505_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697507_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697508_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697509_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB697512_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB775198_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB775199_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB775200_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB775201_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB937792_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB937793_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AB937794_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF043580_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF297624_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AJ012207_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AM295795_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AM295797_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY128092_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY862867_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY862868_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EF208113_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU086721_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU414133_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594383_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594384_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594385_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594387_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594389_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594390_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594391_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594392_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594393_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594394_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU594395_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859899_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859900_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859901_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859902_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859903_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859904_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859905_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859906_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859907_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859908_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859909_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859910_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859911_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859913_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859914_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859915_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859916_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859917_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859918_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859919_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859920_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859921_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859922_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859923_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859924_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859925_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859926_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859927_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859928_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859929_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859930_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859931_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859932_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859933_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859935_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859936_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859937_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859939_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859940_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859941_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859942_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859943_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859945_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859946_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859947_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859948_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859949_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859950_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859953_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
FJ349222_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
FJ349224_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ414522_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477461_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477467_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477470_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477479_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477482_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477487_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477490_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477503_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563546_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563553_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563554_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563555_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563557_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563558_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563562_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ687529_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707534_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707541_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707544_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707546_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707547_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707548_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707552_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707555_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707557_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707560_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707562_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707563_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707564_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707565_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707566_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707567_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707568_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707570_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707573_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707609_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707610_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707611_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707612_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707613_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707614_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707615_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707616_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707617_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707618_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707619_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707620_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707621_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707622_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707623_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707624_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707625_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707626_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707627_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707628_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707629_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707630_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707631_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707632_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707633_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707634_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707636_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707637_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX096953_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX310721_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX310722_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX310723_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX310724_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JX310725_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779211_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779227_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779231_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779243_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779244_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779245_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779246_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779247_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779248_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779249_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779251_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779252_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779253_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779254_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779255_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779256_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779257_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779258_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779259_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779262_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779271_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779273_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779274_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779275_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779277_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779279_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779281_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779282_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779286_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779287_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779290_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779291_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779294_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779299_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779304_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779305_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779306_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779307_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779309_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779310_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779313_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779314_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779315_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779316_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779317_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779319_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779320_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779321_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779322_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779323_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779324_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779325_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779326_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779328_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779330_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779333_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779335_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779336_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779338_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779339_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779342_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779346_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779347_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779350_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779352_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779355_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779362_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779363_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779364_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779366_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779368_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779369_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779370_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779371_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779372_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779373_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779378_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779379_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779383_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779385_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779386_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ586809_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843166_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843173_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843184_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843188_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843192_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843214_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843215_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ854708_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ854710_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KM606742_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KM606746_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KM606749_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP274927_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP274928_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718087_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718088_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718090_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718091_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718092_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718093_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718094_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718096_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718097_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718098_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718099_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718100_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KP718101_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749824_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749829_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749830_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749831_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749832_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749835_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749836_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749837_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749840_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749843_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749844_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749850_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KU605532_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KX827293_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KX827298_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KY003230_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KY382410_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
L13994_HBSP_P-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC074724_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC311241_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC311242_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC311243_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC430617_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC458430_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC458431_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC517161_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC592168_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC592169_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC592170_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC677081_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC677082_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
LC677083_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MH932713_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MT426093_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MT426094_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MT426095_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MT426097_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999477_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999478_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999479_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999480_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999481_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999484_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999486_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999488_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999489_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999490_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999491_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999492_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999493_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999495_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999496_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999497_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999498_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999499_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999500_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999501_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999502_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999504_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999505_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999507_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999508_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999509_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999513_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999514_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999515_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999516_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999518_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999520_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999521_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999522_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999524_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999527_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999528_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999529_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999530_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999531_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999532_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999535_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999537_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999539_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999540_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999541_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999542_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999545_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999547_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999548_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999549_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999550_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999551_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999554_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999556_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999557_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999558_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999559_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999560_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999562_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999563_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999564_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999565_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999566_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999571_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999572_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999573_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999574_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999577_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999578_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999579_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999580_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999583_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999584_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999586_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999587_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999589_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999590_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999592_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999596_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999599_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999600_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043026_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043036_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043040_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043042_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043047_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043055_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043069_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043072_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043084_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
OK106253_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
X70185_HBSP_P-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
Z35717_HBSP_P-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859898_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AF536524_HBSP_P-A      QQQPVRDHARPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
HM363613_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHPGLSQNTY
AB246335_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB453986_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AF090842_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY161143_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY161144_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY373432_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF214657_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF214661_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF214663_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF214665_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ194506_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KM243029_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT366469_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT366471_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925361_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925372_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MT426088_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999476_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999485_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999523_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999525_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999543_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999544_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999561_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999570_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999585_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999588_HBSP_P-A      QQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AF297621_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233290_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357647_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
OK274310_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB453987_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB937791_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AB937796_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AF297625_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233278_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233282_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY233283_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934769_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934770_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934771_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY934774_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
EU410082_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692557_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692562_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692563_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692574_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199974_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199978_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FM199979_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
GU563545_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
GU563548_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
HM535200_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JX154579_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JX154580_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JX154581_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
JX154582_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922424_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922425_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922426_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922427_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF922428_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854693_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854695_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854700_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854707_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KM519452_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KM519453_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KM606748_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168423_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168425_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP718085_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP718086_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT347088_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT347091_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KT347092_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KU605535_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KU736920_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357642_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357645_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357650_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF772351_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925368_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464812_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464815_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MH464828_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512456_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512457_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512458_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512459_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512461_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512465_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512467_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512470_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512472_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MK512473_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999553_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MZ043088_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON585702_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON854582_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999526_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999536_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999552_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MW999575_HBSP_P-A      QQQPVREHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859938_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477466_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MG877723_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MG877724_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MG877725_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KP718089_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749846_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749847_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KT749849_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ184324_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707531_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707533_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707535_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707538_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707539_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707540_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707542_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707543_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707545_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707561_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707569_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707571_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ854686_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854691_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854692_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854694_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854696_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854702_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KJ854705_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
KX357640_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MK512471_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MK512476_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999494_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999555_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999567_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999576_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999591_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MW999595_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
MZ043030_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTY
AF090840_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHRPGLSQNTY
AY902775_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
GQ477464_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707303_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707304_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707307_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707309_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707310_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707312_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707315_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707318_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707321_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707323_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707332_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707334_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707336_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707338_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707343_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707371_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707372_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707373_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707374_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707375_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707376_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707377_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707378_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707379_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707380_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707381_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707382_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707383_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707384_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707385_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707386_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707387_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707388_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707389_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707390_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707391_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707392_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707393_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707394_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707396_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
JQ707399_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779234_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779260_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779263_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779269_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779283_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779298_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779312_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779331_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779337_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779344_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779345_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779348_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779349_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779351_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779354_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779356_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779358_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779359_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779361_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779374_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KF779375_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KX827294_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KX827295_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KX827296_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MF772350_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
MZ043083_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
X51970_HBSP_P-A        QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
DQ788728_HBSP_P-A      QQQPVRDRAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AJ309371_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHRPGLSQNTY
AM184126_HBSP_P-A      PQPPVRDPAEPARLLHKATLCFPHVAVQNLRTEIALVFPSHHPGLSQNTY
EU054331_HBSP_C-A      PQPPVRDPAEPARLLHKATLCFPHVAVQNLRTEIALVFPSHHPGLSQNTY
AY707087_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
ON093162_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
EU859951_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859954_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
EU859956_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GU563550_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439833_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439834_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439835_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439837_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439839_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439841_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439844_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439845_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439847_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439848_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439851_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439852_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439853_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439857_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439859_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439867_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707595_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707638_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707639_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707640_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707641_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707642_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707643_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707644_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707645_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707646_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707647_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707648_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707649_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707650_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707651_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707652_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707653_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707654_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707655_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707656_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707658_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707659_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707661_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707662_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707663_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707664_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707665_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707667_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707669_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707670_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707672_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707675_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707676_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707681_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KM519454_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY161139_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF779367_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
MT426098_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
MT426099_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
AY934773_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854557_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854578_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
ON854586_HBSP_P-A      PQQPARDPAGPARLLLKATLCFPHVAVQNLRMEIALVFPSHHLGLSQNTY
AY934766_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692566_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875251_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875252_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875253_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875254_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875255_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KC875256_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KF214658_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854687_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854688_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KJ854690_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168430_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KP168432_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925385_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925407_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999568_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MW999569_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
AY738140_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY738141_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY738142_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
AY738143_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ161813_HBSP_P-A      PQQPARDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLSQNTY
KU736918_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
KU736919_HBSP_P-A      PQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHPGLSQNTY
EU185789_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRMEXAPVXXSHRPGLXQNTY
KT749838_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707574_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707579_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707580_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707584_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707587_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707588_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707591_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707593_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707596_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707600_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707601_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707602_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
JQ707605_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNSY
FJ692579_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692580_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692581_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692582_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692583_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692584_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692585_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
KJ854698_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHLGLSQNTY
FJ692591_HBSP_P-A      QQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAHVFPSHHLGLSQNTY
KX357644_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
KX357649_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
MF925400_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
ON854566_HBSP_P-A      PQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTY
FJ692598_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692601_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692602_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
FJ692604_HBSP_P-A      PQPPVRDPAEPARLLLKATLCFPHVAVPNLRTEIAPVFPSHHPGLSQNTY
MW999533_HBSP_P-A      QQQPVRDHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JQ707551_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779381_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043075_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
GQ477500_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KF779266_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRHGLSQNTY
KJ843182_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843186_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
KJ843218_HBSP_P-A      QQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043062_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MF772348_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLSQNTY
KP995108_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043054_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
MZ043077_HBSP_P-A      QQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTY
JF439722_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439729_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439730_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439742_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439743_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439745_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439746_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNSY
JF439723_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439724_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439732_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439733_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439735_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439736_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439737_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439738_HBSP_P-A      PQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHPGLSQNTY
JF439751_HBSP_P-A      PQQPVRDPAEP