HBVdb

Dataset for protein MHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***** ********..*..**:************.***.* ****:*.****.***:******     ***.* * ***:
MQWNSTQFHQALLDPRVRGLYfPAGGSSSETQNPAPTIaSLTSSIFSKTGDPaMNMENITSGLLGPLLVLQAVCFLLTKI
     i        tk ka  l            v   v h    l t    v   k      prlrp   g f s   v
                                                                           w    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .:*: ********* * ********. *** ****  **********.****** ******** ** ************
lTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
rkm kr         s e        sx   t    qi          r      t        g  s            
x                                                                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************* ***.******** *****************:*:***:************. *.*****
VCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVG
                     x   p        i                 l n   d            ap a     
                                                                                

       250       260       270       280  
....:....|....:....|....:....|....:....|..
*** **  .:**:*******  ** **************** 
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
   i  psam  m       yn  r                x
                     i                    
© 1998-2020Legal notice