HBVdb

Dataset for protein LHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************* ***************:****.******.*.******************
MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVGGFGPGFTPPHGGLLGWSPQ
                               x               d    a      a a                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:** ** *****..*****:*****.*** ***        .. :. **..**** :************.***.**
AQGILTTsPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIaSL
    m  l  v     nt     q     s   h   xxxxxxxlrhthpq  sk    cl            v   v  
                                            i                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*** *******.***:******* ** ***.* * ***: ***:************ ********* ********  ***
TSSIFSKTGDPaMNMENITSGLLGPLLVLQAVCFLLTKILTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCP
   t       v   k       r  p   g f s   vx   k            e         x        qi   
                                       r                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******.*************** ************************************ ***.******** ******
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGN
       r               g                                    x   p        i      
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********:*:***:************. *.******** **  .:**:******* .** ****************
CTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFvQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
           l n   d            ap a        i  psam  m       yn  r                
                                                                                
© 1998-2022Legal notice