HBVdb

Dataset for protein HBc of genotype G

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:**********:*** ****:*****:******:* ***: ***  *.:*:*:*: **:*******.**:***.**:***
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
m          s              i             a   pe                           s      
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:*.*.***.*:******:******** **.:**************** .***************:*****.*.*****
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
      s   v l                  k                 l                              
                                                                                
                                                                                

       170       180   
....:....|....:....|...
***.*.* ***.* ** *  .**
PSPRRRRSQSPRRRRSASPASQC
             k  q qe   
                     
                     
© 1998-2022Legal notice