HBVdb

Dataset for protein MHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       **              *. *:. *   .  *.   **    **  . .::.  *     *    .       :
MQWNSTQFHQALLDPRVRALYfPAGGSSSeTQNPAPTIASLTSSIFsKTGGPAmNMdNITSGLLGPLLVLQAVCFLLTKI
---- s    t    k k  cl       g    v    x    tslt  al t  ests             fss i  
v                                            yx                          s      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *  *:  * *  **     *  **  ******* * ** **  **     * **** *** ** *****:* .* **
LTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
rkm        rs  eet x                                                  v       
                  ap                                                            
                  x                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***   *   * ** *. **. *  * *.*****:.**:***********  :* :**  .*  * ** **: ***    
VCPLlPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVG
    i   s                         t                               n           
                                                                    x           
                                                                                

       250       260       270       280 
....:....|....:....|....:....|....:....|.
:** **     *****             *: ** * * * 
LSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
   i     m          fnt                  
                                         
                                         
© 1998-2022Legal notice