HBVdb

Dataset for protein LHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**** *  *** * **:*******:* **:**:*.:*:...:**:*  *  **:**** .*  :***** *****:****
MGAPLSTTRRGMGqNLSVPNPLGFfPdHQLDPLFRANSSSPDWDFNknKDnWPMANKVGVG-GYGPGFTPPHGGLLGWSP
             l          l e       k   n       tt  t           a                 
                          b                    d  s                             
                                               x                                
                                               s                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *** *:* . :** :.***    :*   * *:.****:.  ..   **              *. *:. *   .  *. 
QAQGVLTTLPADPPPASTNRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYfPAGGSSSeTQNPAPTIAS
    m   s vn    p    t                    tsk   t    k k  cl       g    v    x
                                                x         sx                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  **    **  . .*:.  *     *    .      .:   *  *:  * *  **   . *  **  ******* * *
LTSSIFsKTGGPAmNMdNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSC
    tslt  alvt  ests    r        fss i  rkm rn       rs  eet x                  
     yx    x                   s                        ap                    
                                                          x                     
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* **  **     * **** *** ** *****:* .* *****   *   * ** *. **.**  * *.*****:.**:*
PPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLlPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
                                v           in -s-    a r                 t     
                                            t   -                               
                                                m                               
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********  :* :**  .*  **** **: ***    :** **     *****             *: ** * * *
NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVS
                          n              i  x xm        k fntw              g 
                            x              x                                    
                                                                                
                                                                                

 
.
 
I
 
 
 
 
© 1998-2022Legal notice