HBVdb

Dataset for protein LHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**** ** *** * **:*******:* **:**:*.:*:...:**:*  *  **:**** .*  :***** *****:****
MGAPLSTTRRGMGqNLSVPNPLGFfPDHQLDPLFRANSSSPDWDFNknKDnWPMANKVGVG-GYGPGFTPPHGGLLGWSP
             l          l e       k   n       td  s           a                 
                          b                    t  t                             
                                               x                                
                                               s                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**** *:* . :** :.***    :*   * *:.****:.  ..   **              *. *:. *   .  *. 
QAQGVLTTLPADPPPASTNRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYfPAGGSSSeTQNPAPTIAS
    m   s  n    p    t                    tsk   t    k k  cl       g    v    x
                                                          sx                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  **    **  . .*:.  *     * *  .      .:   *  *:  ***  **   . *  *** ******* * *
LTSSIFsKTGGPAmNMdNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSC
    tslt  alvt  ests    r        fss i  rkm rn        s  eet                    
     yx      x                   s                        a                     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* **  **     * **** *** ** *****:* .*:*****   *       * ** *. **.**  * *.*****:.
PPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLlPG----STTTSTGPCKTCTTLAQGTSMFPSCCCSK
                                v           in     ---      r                 t 
                                            t                                   
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:***********. :* :**  .*  **** *** *** *  :** **** : *****             *: ** *
PSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCY
                              n              i     m           nt             
                                x                                               
                                                                                
                                                                                

     
....:
 * * 
LWVSI
  g  
     
     
     
© 1998-2020Legal notice