HBVdb

Dataset for protein SHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *    *    .     :   *  *   .   **       .   *         *     *    .      *  
MEsITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVClGQNSQSPtSnHSPTSCPPICPGYRWMCLRRF
--g-  r      a     s                   s   es   r   l   i s        t            
  n                                        xt   p                               
  x                                             x                               
  -                                                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *              :   *.  *  . .  *  .: *      *  *  *.  .   . ..  ** *     
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGK
 x                  h        l                p h            e                
                                              x                                 
                                                                                
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
 ** .   *             *   .                 :         *      *    
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
   g          s        v    i   l m       rn   t r   l xl  l   a  
   v                        x             xr                      
                                           x                      
                                           g                      
© 1998-2022Legal notice