HBVdb

Dataset for protein HBe of genotype C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :                                         .     :                         *.
SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLA
         s    h       a  i     a    nv       t  h          ta    i   vv  v      
         d    t                                                                 
                                                                                

        90       100       110       120       130      
....:....|....:....|....:....|....:....|....:....|....:.
.    *            :.    .                          ..   
TWVGSNLEDPASRELVVsYVNVNMGLKiRQLLWFHISCLTFGRETVLEYLVSFGVW
    g  d     dai g   i     l  i           sa            
                           f               q            
                                           d            
© 1998-2022Legal notice