HBVdb

Dataset for protein HBe of genotype B

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .   .                    :            :  .    .     * 
SKLCLGWLWGMDIDpYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLA
        xd    t      ta        t    nv       t  h          t       vv  v   t  
              h       m                      a                           d      
              x                                                                 

        90       100       110       120       130      
....:....|....:....|....:....|....:....|....:....|....:.
 .   .*         .                .      :               
TWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
  e g  d q   da  g       i l  i           k             
                 n                                      
                                                        
© 1998-2022Legal notice