HBVdb

Dataset for protein HBe of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *          .    :*.  .:  .:  .  *   :   .        *         *.*              : 
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLA
         d           sa             a          f  s       t     i   v   vdvt n g
                                                                                

        90       100       110       120       130      
....:....|....:....|....:....|....:....|....:....|....:.
 * . *:    .      :::   .:        :  .  **   .  :: . *  
TWVGNNLeDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
    t  q      q                          d            
       d                                   q            
© 1998-2022Legal notice