HBVdb

Dataset for protein HBc of genotype G

[Download (right click)] [Alignment] [Repertoires]

102 sequence(s)

>gnl|hbvpro|AB056513_HBc_P-G Product feature CHAIN AB056513_HBc_P-G of FT:mat_peptide AB056513_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNLGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB056514_HBc_P-G Product feature CHAIN AB056514_HBc_P-G of FT:mat_peptide AB056514_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB056515_HBc_P-G Product feature CHAIN AB056515_HBc_P-G of FT:mat_peptide AB056515_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSVHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB064310_HBc_P-G Product feature CHAIN AB064310_HBc_P-G of FT:mat_peptide AB064310_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB064311_HBc_P-G Product feature CHAIN AB064311_HBc_P-G of FT:mat_peptide AB064311_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB064312_HBc_P-G Product feature CHAIN AB064312_HBc_P-G of FT:mat_peptide AB064312_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHAALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB064313_HBc_C-G Product feature CHAIN AB064313_HBc_C-G of FT:mat_peptide AB064313_HBc_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375165_HBc_P-G Product feature CHAIN AB375165_HBc_P-G of FT:mat_peptide AB375165_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375166_HBc_P-G Product feature CHAIN AB375166_HBc_P-G of FT:mat_peptide AB375166_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375167_HBc_P-G Product feature CHAIN AB375167_HBc_P-G of FT:mat_peptide AB375167_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375168_HBc_P-G Product feature CHAIN AB375168_HBc_P-G of FT:mat_peptide AB375168_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375169_HBc_P-G Product feature CHAIN AB375169_HBc_P-G of FT:mat_peptide AB375169_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AB375170_HBc_P-G Product feature CHAIN AB375170_HBc_P-G of FT:mat_peptide AB375170_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AF160501_HBc_C-G Product feature CHAIN AF160501_HBc_C-G of FT:mat_peptide AF160501_HBc_C-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|AF405706_HBc_P-G Product feature CHAIN AF405706_HBc_P-G of FT:mat_peptide AF405706_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 235/01). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|DQ207798_HBc_P-G Product feature CHAIN DQ207798_HBc_P-G of FT:mat_peptide DQ207798_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|EF464097_HBc_P-G Product feature CHAIN EF464097_HBc_P-G of FT:mat_peptide EF464097_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 06hac). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|EF464098_HBc_P-G Product feature CHAIN EF464098_HBc_P-G of FT:mat_peptide EF464098_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 09hgg). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|EF634480_HBc_P-G Product feature CHAIN EF634480_HBc_P-G of FT:mat_peptide EF634480_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|FJ023674_HBc_P-G Product feature CHAIN FJ023674_HBc_P-G of FT:mat_peptide FJ023674_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate I2/C2_C04-0790). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FR714503_HBc_P-G Product feature CHAIN FR714503_HBc_P-G of FT:mat_peptide FR714503_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate TZ306). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMTLATWVGSNLDDPA
SRDLVVSYVNVNMGLKIRQILWFHISCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU563556_HBc_P-G Product feature CHAIN GU563556_HBc_P-G of FT:mat_peptide GU563556_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BV-55). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981171_HBc_P-G Product feature CHAIN HE981171_HBc_P-G of FT:mat_peptide HE981171_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLAVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981172_HBc_P-G Product feature CHAIN HE981172_HBc_P-G of FT:mat_peptide HE981172_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981174_HBc_P-G Product feature CHAIN HE981174_HBc_P-G of FT:mat_peptide HE981174_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981175_HBc_P-G Product feature CHAIN HE981175_HBc_P-G of FT:mat_peptide HE981175_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981176_HBc_P-G Product feature CHAIN HE981176_HBc_P-G of FT:mat_peptide HE981176_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|HE981188_HBc_P-G Product feature CHAIN HE981188_HBc_P-G of FT:mat_peptide HE981188_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPHRRRSQSPRRKRSASPASQC
>gnl|hbvpro|HE981189_HBc_P-G Product feature CHAIN HE981189_HBc_P-G of FT:mat_peptide HE981189_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439779_HBc_P-G Product feature CHAIN JF439779_HBc_P-G of FT:mat_peptide JF439779_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439780_HBc_P-G Product feature CHAIN JF439780_HBc_P-G of FT:mat_peptide JF439780_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03D4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439781_HBc_P-G Product feature CHAIN JF439781_HBc_P-G of FT:mat_peptide JF439781_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03G3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439782_HBc_P-G Product feature CHAIN JF439782_HBc_P-G of FT:mat_peptide JF439782_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439784_HBc_P-G Product feature CHAIN JF439784_HBc_P-G of FT:mat_peptide JF439784_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03E12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439785_HBc_P-G Product feature CHAIN JF439785_HBc_P-G of FT:mat_peptide JF439785_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439786_HBc_P-G Product feature CHAIN JF439786_HBc_P-G of FT:mat_peptide JF439786_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439787_HBc_P-G Product feature CHAIN JF439787_HBc_P-G of FT:mat_peptide JF439787_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439788_HBc_P-G Product feature CHAIN JF439788_HBc_P-G of FT:mat_peptide JF439788_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439789_HBc_P-G Product feature CHAIN JF439789_HBc_P-G of FT:mat_peptide JF439789_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439791_HBc_P-G Product feature CHAIN JF439791_HBc_P-G of FT:mat_peptide JF439791_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ANG03F12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439792_HBc_P-G Product feature CHAIN JF439792_HBc_P-G of FT:mat_peptide JF439792_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASQASQC
>gnl|hbvpro|JF439793_HBc_P-G Product feature CHAIN JF439793_HBc_P-G of FT:mat_peptide JF439793_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2004G4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASQASQC
>gnl|hbvpro|JF439794_HBc_P-G Product feature CHAIN JF439794_HBc_P-G of FT:mat_peptide JF439794_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H1). Partial genome (Contains: HBc, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439795_HBc_P-G Product feature CHAIN JF439795_HBc_P-G of FT:mat_peptide JF439795_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H2). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439796_HBc_P-G Product feature CHAIN JF439796_HBc_P-G of FT:mat_peptide JF439796_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H3). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASQASQC
>gnl|hbvpro|JF439797_HBc_P-G Product feature CHAIN JF439797_HBc_P-G of FT:mat_peptide JF439797_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H4). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRESLESSDHCSPHHTALSQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRQRSQSPRRKRSASPASQC
>gnl|hbvpro|JF439799_HBc_P-G Product feature CHAIN JF439799_HBc_P-G of FT:mat_peptide JF439799_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H7). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439800_HBc_P-G Product feature CHAIN JF439800_HBc_P-G of FT:mat_peptide JF439800_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H8). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439801_HBc_P-G Product feature CHAIN JF439801_HBc_P-G of FT:mat_peptide JF439801_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H9). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASQASQC
>gnl|hbvpro|JF439802_HBc_P-G Product feature CHAIN JF439802_HBc_P-G of FT:mat_peptide JF439802_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate BIL2005H10). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439803_HBc_P-G Product feature CHAIN JF439803_HBc_P-G of FT:mat_peptide JF439803_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439804_HBc_P-G Product feature CHAIN JF439804_HBc_P-G of FT:mat_peptide JF439804_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439805_HBc_P-G Product feature CHAIN JF439805_HBc_P-G of FT:mat_peptide JF439805_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439806_HBc_P-G Product feature CHAIN JF439806_HBc_P-G of FT:mat_peptide JF439806_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439807_HBc_P-G Product feature CHAIN JF439807_HBc_P-G of FT:mat_peptide JF439807_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439808_HBc_P-G Product feature CHAIN JF439808_HBc_P-G of FT:mat_peptide JF439808_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439809_HBc_P-G Product feature CHAIN JF439809_HBc_P-G of FT:mat_peptide JF439809_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439810_HBc_P-G Product feature CHAIN JF439810_HBc_P-G of FT:mat_peptide JF439810_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439811_HBc_P-G Product feature CHAIN JF439811_HBc_P-G of FT:mat_peptide JF439811_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439812_HBc_P-G Product feature CHAIN JF439812_HBc_P-G of FT:mat_peptide JF439812_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439813_HBc_P-G Product feature CHAIN JF439813_HBc_P-G of FT:mat_peptide JF439813_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439814_HBc_P-G Product feature CHAIN JF439814_HBc_P-G of FT:mat_peptide JF439814_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439815_HBc_P-G Product feature CHAIN JF439815_HBc_P-G of FT:mat_peptide JF439815_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439816_HBc_P-G Product feature CHAIN JF439816_HBc_P-G of FT:mat_peptide JF439816_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439817_HBc_P-G Product feature CHAIN JF439817_HBc_P-G of FT:mat_peptide JF439817_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JF439818_HBc_P-G Product feature CHAIN JF439818_HBc_P-G of FT:mat_peptide JF439818_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate FOL04H11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707436_HBc_P-G Product feature CHAIN JQ707436_HBc_P-G of FT:mat_peptide JQ707436_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MC1_C27). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNLGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707657_HBc_P-G Product feature CHAIN JQ707657_HBc_P-G of FT:mat_peptide JQ707657_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_1). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASQASQC
>gnl|hbvpro|JQ707660_HBc_P-G Product feature CHAIN JQ707660_HBc_P-G of FT:mat_peptide JQ707660_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_17). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707666_HBc_P-G Product feature CHAIN JQ707666_HBc_P-G of FT:mat_peptide JQ707666_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_22). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707668_HBc_P-G Product feature CHAIN JQ707668_HBc_P-G of FT:mat_peptide JQ707668_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_26-5). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707671_HBc_P-G Product feature CHAIN JQ707671_HBc_P-G of FT:mat_peptide JQ707671_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_3). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707673_HBc_P-G Product feature CHAIN JQ707673_HBc_P-G of FT:mat_peptide JQ707673_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_33). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRGRSASPASQC
>gnl|hbvpro|JQ707677_HBc_P-G Product feature CHAIN JQ707677_HBc_P-G of FT:mat_peptide JQ707677_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_45). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707678_HBc_P-G Product feature CHAIN JQ707678_HBc_P-G of FT:mat_peptide JQ707678_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_47). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707679_HBc_P-G Product feature CHAIN JQ707679_HBc_P-G of FT:mat_peptide JQ707679_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_48). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JQ707680_HBc_P-G Product feature CHAIN JQ707680_HBc_P-G of FT:mat_peptide JQ707680_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate S11_6). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JX899374_HBc_P-G Product feature CHAIN JX899374_HBc_P-G of FT:mat_peptide JX899374_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBcMX-117G). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|JX899375_HBc_P-G Product feature CHAIN JX899375_HBc_P-G of FT:mat_peptide JX899375_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBcMX-143G). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF414679_HBc_P-G Product feature CHAIN KF414679_HBc_P-G of FT:mat_peptide KF414679_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate B213). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF767450_HBc_P-G Product feature CHAIN KF767450_HBc_P-G of FT:mat_peptide KF767450_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_23). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHSSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF767451_HBc_P-G Product feature CHAIN KF767451_HBc_P-G of FT:mat_peptide KF767451_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_27). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF767452_HBc_P-G Product feature CHAIN KF767452_HBc_P-G of FT:mat_peptide KF767452_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate patient_7). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF779233_HBc_P-G Product feature CHAIN KF779233_HBc_P-G of FT:mat_peptide KF779233_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6090). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KF779235_HBc_P-G Product feature CHAIN KF779235_HBc_P-G of FT:mat_peptide KF779235_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6106). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASSASQC
>gnl|hbvpro|KF779357_HBc_P-G Product feature CHAIN KF779357_HBc_P-G of FT:mat_peptide KF779357_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate PNF5187). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KJ194508_HBc_P-G Product feature CHAIN KJ194508_HBc_P-G of FT:mat_peptide KJ194508_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate HBV_Amsterdam_2_1994). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KM998716_HBc_P-G Product feature CHAIN KM998716_HBc_P-G of FT:mat_peptide KM998716_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KR230749_HBc_P-G Product feature CHAIN KR230749_HBc_P-G of FT:mat_peptide KR230749_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate ENDV06GG). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KX264500_HBc_P-G Product feature CHAIN KX264500_HBc_P-G of FT:mat_peptide KX264500_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate G-aej). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|KY004111_HBc_P-G Product feature CHAIN KY004111_HBc_P-G of FT:mat_peptide KY004111_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate M-2015). Complete genome. [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESFDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSTSPASQC
>gnl|hbvpro|M74502_HBc_P-G Product feature CHAIN M74502_HBc_P-G of FT:mat_peptide M74502_HBc_P-G of [Viruses] Hepatitis B Virus genotype G. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MF150677_HBc_P-G Product feature CHAIN MF150677_HBc_P-G of FT:mat_peptide MF150677_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX952M). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MF150678_HBc_P-G Product feature CHAIN MF150678_HBc_P-G of FT:mat_peptide MF150678_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX940M). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MF150679_HBc_P-G Product feature CHAIN MF150679_HBc_P-G of FT:mat_peptide MF150679_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX942M). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MF150680_HBc_P-G Product feature CHAIN MF150680_HBc_P-G of FT:mat_peptide MF150680_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate MEX941M). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MH780889_HBc_P-G Product feature CHAIN MH780889_HBc_P-G of FT:mat_peptide MH780889_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 0.436). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MH780892_HBc_P-G Product feature CHAIN MH780892_HBc_P-G of FT:mat_peptide MH780892_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 0.497). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MH780893_HBc_P-G Product feature CHAIN MH780893_HBc_P-G of FT:mat_peptide MH780893_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 0.210). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MH780896_HBc_P-G Product feature CHAIN MH780896_HBc_P-G of FT:mat_peptide MH780896_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 0.474). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREXLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRYQSPRRRRSASPASQC
>gnl|hbvpro|MH780897_HBc_P-G Product feature CHAIN MH780897_HBc_P-G of FT:mat_peptide MH780897_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate 0.936). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSASPASQC
>gnl|hbvpro|MT426120_HBc_P-G Product feature CHAIN MT426120_HBc_P-G of FT:mat_peptide MT426120_HBc_P-G of [Viruses] Hepatitis B Virus genotype G (isolate DEN6090 transfection clone). Complete genome. [Riboviria] (length=183 residues).
LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPHRRRSASSASQC
© 1998-2022Legal notice