HBVdb

Dataset for protein HBx of genotype all

[Download (right click)] [Edit] [Sequences] [Repertoires]

10589 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774351_HBx_P-C          MAGPMGSRPEPPRGRPCIRRIGGETRGGPVSGPSGPFPSRCPCGAPGAPG
Y18856_HBx_P-RF-CB        MAARLCCQLDPARDILCLRPCGAESRGRPVSGSLGDLPSPSPS-VPADHG
Y18857_HBx_P-RF-CB        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPAFS-VPADHG
KC774246_HBx_P-RF-CB      MVARVCCQVDHWRDVGSLRAVGPESRGRPVSPPWGRLRSPCSFAVPADHG
JX504531_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN688713_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ184326_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
JN664943_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
L27106_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AY741798_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB493846_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU921418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPTDHG
EU921419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT749823_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVPTDHG
JN257159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPTSAVSTDHG
JN792908_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
KC774461_HBx_P-RF-DC      MAARSCCQLDPARDVLFLRPVAVVSGRRPVSGPDGSFRSRLCFAVPAAHG
KC774357_HBx_P-C          MAVRGCCQLDPARDVLGLRPVGVESRGRPVSGPFGHLPSLSSSAVPADHG
KC774196_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC774336_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
EU054331_HBx_C-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHG
KC774475_HBx_P-RF-DC      MAARVFCQLDPAGDVLCLRPVAVVSRRWPMSGPVGSFRSPSSFAVPANHG
KC163999_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
DQ629946_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAYPPSSPSAVPADDG
DQ899144_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899146_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899147_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899145_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
KJ638660_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADDG
KJ638662_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADNG
AB166850_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADHG
AB365446_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098569_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSXASAVPADHG
JF911694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KY476326_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSLASAVPADNG
KJ843185_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
JF911695_HBx_P-F          MGARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPSDDG
MG098582_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPSSPSAVPADNG
MG098584_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGGLPPSSPSAVPSDNG
MG098578_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADYG
MG098565_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843223_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPPGGLPTSSASAVPADHG
JF911696_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPSSASAVPADHG
JF911692_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911678_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
EF576812_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPSSASAVPANHG
DQ629986_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ776247_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366116_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657519_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657522_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911679_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911680_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843207_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843208_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843210_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843213_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
X75658_HBx_C-F            MAARMCCQLDPARDVLCLRPVGAESSGRTLPGPLGALPPSSASAVPADHG
MG098579_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098573_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
KJ843225_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JQ272900_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911693_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLTPSSPSAVPSDNG
DQ823087_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823089_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026746_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026748_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366132_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098566_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843212_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ676694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPXBDG
MG098574_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098575_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK808040_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098583_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098580_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098577_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098564_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KY382411_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KX264499_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843226_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843224_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843222_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843221_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843220_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843219_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843211_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843209_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843189_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843175_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KC494398_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JX079937_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JQ272906_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN811656_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN688709_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADXG
JN811655_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098570_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
MG001259_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ823088_HBx_P-F          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
EF026747_HBx_P-F          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
EF026749_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF576808_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
FJ657528_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
HE981181_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JN688701_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823090_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026745_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365449_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365450_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AF223962_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
AF223965_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ629958_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823086_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KP995104_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPFFPSTVPADDG
AB205010_HBx_P-H          MAARMCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPAVDG
HM117851_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB275308_HBx_P-H          MADRLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998719_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998723_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998720_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPTDDG
AY090454_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDR
AB059659_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB179747_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB266536_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB353764_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPPSSPPVVPADDG
AB375159_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
AB375160_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
KY458060_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KY458059_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KX264501_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998721_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998718_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
HM117850_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSFGALPPSSPPAVPADDG
HM066946_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356716_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356715_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
EU498228_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
EF157291_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090460_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090457_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDG
AB818694_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB375164_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB375163_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375161_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375162_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059660_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059661_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
DQ629996_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSRSLGAVPPPLPSATPADDG
DQ629991_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629941_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVSPHLPSAVPADDG
DQ629937_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
KC494401_HBx_P-F          MAARLCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494396_HBx_P-F          MAARMCCKLDTARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494394_HBx_P-F          MAARMCCKLDPERDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494399_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995120_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494405_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KJ843191_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494395_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494397_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
X69798_HBx_P-F            MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995110_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494402_HBx_P-F          MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494403_HBx_P-F          MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629995_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629967_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPRPLGAIPPSSPSAVPANDG
DQ629965_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629934_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629956_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPPSPSAVPANDG
AY090455_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
DQ629933_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629940_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629950_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629953_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629954_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629997_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
AY311369_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSTVQAYDG
KX264497_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899142_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899143_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629936_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLRGPLGAIPPSSPSAVPANDG
AB064315_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPANDG
DQ629985_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629930_HBx_P-F          MAARLCCQLGPPRDGLYLHPVGADSRGRSLSGSLGVVPHPSQSAVPADDG
KP995107_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995114_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPPGAVPPSSPSAVPADDG
KP995115_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPIGAVPPSSPSAVPADDG
KP995113_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGDVPPSSPSAVPADDG
KP995105_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995097_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGSLGAVPPSSPSAVPADDG
DQ629947_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KJ638664_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPPDDG
DQ629993_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KP995101_HBx_P-F          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718107_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSSSAVPADDG
KJ843196_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843199_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843195_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843163_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272894_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAISPPSPSAVPADDG
JF911673_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
HM622135_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629944_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRFLSGSLGVVPPPSPSAVPADDG
DQ629935_HBx_P-F          MAARLCCQMDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB116552_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
AF223964_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AY179735_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823092_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823093_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823094_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823095_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026751_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026752_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026753_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026754_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EU366118_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ657529_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709457_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
FJ709458_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709459_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709460_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709462_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709463_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709464_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709465_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709494_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981182_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981183_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585187_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585188_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585189_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585190_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585191_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585192_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585193_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585195_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585196_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585197_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585198_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSTVPADDG
HM585199_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM590473_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HQ378247_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911674_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911675_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911676_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911677_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN688691_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688699_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688703_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JQ272889_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272890_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272891_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272893_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272895_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272898_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272899_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272901_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272904_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272905_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272907_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272908_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272909_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272910_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272913_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272914_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KC494400_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KC494404_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ586805_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586806_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586807_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586808_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843167_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843171_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
KJ843174_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843176_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843179_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843180_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843190_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843197_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843198_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843200_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843201_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843203_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843206_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM998715_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995116_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KX264496_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382415_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458061_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458062_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPANDG
MF593354_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593367_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MK058437_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
MK808039_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KT896494_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
FJ589065_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSFGAVSPPSPSAVPANDG
AB064316_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AF223963_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823091_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF026750_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EU366133_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843164_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843168_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843169_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843170_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843181_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843193_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843194_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843204_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382416_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593356_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593360_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593376_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593380_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995118_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGAVPPPSSSAVPADNG
KP995098_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
KP718110_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM233681_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
KJ843202_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792920_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585200_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
FJ657525_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ589067_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
EU670261_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF397982_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
DQ899148_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADHG
DQ629989_HBx_P-F          MAARLCFQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629978_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629960_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSSSAVPADDG
DQ629959_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
DQ629943_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629932_HBx_P-F          MAAGMCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB036910_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADHG
MH051986_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MH051987_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KJ843205_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382417_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MG001258_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585194_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
HM627320_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
DQ629951_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629955_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629981_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629994_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB116654_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPSSPSAVPADDG
DQ629977_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629988_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSTSAVPADDG
AB116551_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
DQ899149_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718112_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
AB036914_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036915_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036916_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036917_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036918_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036919_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036911_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
AB036920_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
KP718103_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPPSSSAVPADDG
KJ638663_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AB036905_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036906_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036907_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036908_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036909_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036912_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036913_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB116549_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB116550_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AY311370_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
DQ899150_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB086397_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090456_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629962_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629968_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629972_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
DQ629974_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629979_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629990_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629992_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
EU670260_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792914_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792916_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792917_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792918_HBx_P-F          MAARLCCQLDPTRDVLCLRPVRAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792919_HBx_P-F          MAARLCCQLDPTRDVLCLRTVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792922_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JX079936_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638656_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638657_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPABDG
KY476324_HBx_P-F          MAARLYCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
KY476325_HBx_P-F          MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476327_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476328_HBx_P-F          MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476330_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476331_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
X75663_HBx_P-F            MAARLCCQLDPARDVLCLRPVGAESSGRTLPGSLGAVPPPSSSAVPADNG
KY476329_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629938_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AY090458_HBx_C-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
AY090459_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090461_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
DQ629931_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629945_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629948_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629949_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629961_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629963_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629964_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629966_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629969_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629971_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629973_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629987_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
EU670262_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585186_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590471_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590472_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590474_HBx_P-F          MAAWLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
JQ272892_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843177_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843178_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP718104_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP718113_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995126_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSPGAVPPPSSSAVPADDG
KP995109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MF593371_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRPLSGSLGAVSPPSPSAVPADDG
KY476332_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476323_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476322_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX264498_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
KP995125_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995124_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
KP995123_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995119_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVSPPSSSAVPADDG
KM659861_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
FJ589066_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KJ638659_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX757665_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGSFGAVSPPSPSAVPANDG
KP995117_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGAVPPPSSSAVPADDG
KP718111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KC774244_HBx_P-C          MVARVCCQVDHARDVLSLRPVGAESRGRPISGPFGTLRSHCSFAVPADHG
EU939637_HBx_P-B          MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHG
AB933282_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB933283_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPXDHG
JQ707469_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPFPSAVPADHG
JQ707468_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU833889_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707421_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707424_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707426_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707430_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707432_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707441_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707448_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707450_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707456_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707457_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707458_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707459_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707460_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707461_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707462_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707463_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707464_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707465_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707466_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPIGTLSSPSPSAVPADHG
JQ707467_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707470_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707471_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707472_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707473_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707475_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707445_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EF464097_HBx_P-G          MAARLCCHIDPFRDVLCLRPVSVESSGRPLLGSFGDLSPPSPSAVPADHG
KR811785_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811774_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056514_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSTPSPFAVPADHG
JQ272887_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EU833890_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811794_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811793_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811783_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811780_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811775_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811767_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811460_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811461_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811765_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811768_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811770_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811771_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811772_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811773_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811776_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811777_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSTVPADHG
KR811781_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811782_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811784_HBx_P-G          MAARLCCQLDPSRDVPCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811786_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811788_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811789_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811790_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811791_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811792_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811795_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811797_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811800_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811802_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811804_HBx_P-G          MAARLCCQLDPTRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811806_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811807_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KM998716_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767451_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707677_HBx_P-G          MAARLCCQLDPSRDVLCLRPDSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707657_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707660_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707666_HBx_P-G          MAARLCCHLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707668_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707671_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707673_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707678_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707679_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707680_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPAAHG
GU563556_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF219922_HBx_P-RF-GH      VAAGLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707436_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KJ194508_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056513_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056515_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056516_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064310_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064312_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375165_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375166_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375167_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375168_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375169_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375170_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF160501_HBx_C-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF405706_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
DQ207798_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF464098_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF634480_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
GU565217_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981171_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981172_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981174_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
HE981175_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981176_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF414679_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767450_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767452_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR230749_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX264500_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KY004111_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933279_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933280_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933281_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981179_HBx_P-RF-FG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981180_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHE
JQ272886_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KP274926_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064311_HBx_P-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064313_HBx_C-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KC774368_HBx_P-B          MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHG
AB100695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHG
KC774180_HBx_P-C          MVPRVCGQLDPARDVRCLRPVGPESRGPPVSRPLGPLWSPFSFAVPANRG
KC774445_HBx_P-D          MAVRLCCQLDRARDVLCLRPVGAESRGRPFSGPLGILLSLCPFAVSSDPG
KC774227_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFLFAVPTDHG
MH488840_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774200_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPTLFAVPADHG
KC774271_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPTDHG
EU939542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899767_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPVVPTDHG
AB112065_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
KJ803795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
HM363606_HBx_P-E          MAARLCCQLAPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KR811476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRSVSGPLGDLPSPSSSAGPADHG
HM750131_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPISGPFGSLPSPPSSALPADHG
MK171606_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
JN040822_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSADHG
JN040782_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSSDHG
GQ922003_HBx_P-D          MAARLCCQLDPARDXLCLRPLSAESRGRPXSGPLGPLSSSSLPAVPTDHG
KY881821_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAECSEGHSTGTLRALPPASPSVVQTEHG
DQ993702_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHG
KC315400_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
GQ205379_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGSLSSSPPSAVPTDHG
HM363605_HBx_P-E          MAARLCCQLDPARDVLCIRPVSAESCGRPISGSLGDLPSPSPSAVPAVHG
MK052948_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052951_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MG776612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776392_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFAGPLGTFSSPSPSAVSTDHG
GQ922005_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPLGPLSSSSLPAVPPDHG
GQ922004_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPISXPLGSLSSSSLPAVPTNHG
KU964189_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964190_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964191_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964192_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964199_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KT235627_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTIPSPSPSAVPSDHG
KT235628_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTIPSPSPSAVPSDHG
KC774217_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
KC774432_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
FJ386624_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
GQ372968_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
DQ089797_HBx_P-C          MAGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
AY217364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHG
HQ700520_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPLGTLPSPSSPAVPAHHG
AB915178_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY796031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGIFSSPSPSAVSSDHG
FJ787441_HBx_P-C          MAARMCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPLVPTDHG
MN066401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
KP168416_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGVESCGRPVSGPLGAFSSPSLPAVPTDHG
HQ700531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HM146131_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
FN545827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
JN642167_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFSSPSPSAVSTDHG
FJ904439_HBx_P-D          MAARLCCQLDPTRDVLCLRPLGAESCGRPFSGPLGDLSSSSLPAVPADHG
AY161158_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AB674415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSSDHG
AB555501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSSDHG
AB555496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPHPFAVSSDHG
KP148473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC774290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB493839_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPVAGPLGGLPSPSSSAVPADHG
MK171290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPLLPTBHG
JQ341831_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHG
JQ341813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHG
AP011093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHG
AB048705_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDG
JQ707510_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707498_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707509_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707497_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707491_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707511_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707477_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707492_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707495_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707501_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707504_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JN574728_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JN664941_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSSSAVSSDHG
KM524352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KM524355_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KX423721_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JQ707493_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRPSPSPSAVSSDHG
JQ707506_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618423_HBx_P-D          MAARLCCQLDPPRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618425_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MN066381_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ803788_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGSLGALPAASSSAVSTDHG
HQ700494_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGXLGXLSSPSLPAVPADHG
GQ331048_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
MH580648_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580640_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580641_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580626_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCRRPVSGSLGDLSSPSPSAVPADHG
MG776503_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161757_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ349226_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDFSSPSPSAVPADHG
AM494706_HBx_P-E          MAARLCCQLDPARDVLCLRPVSVESCGRPVSGSLGDLSSPSPSAVPADHG
AM494699_HBx_P-E          MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN182685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSSDHG
MG776792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSASAVPPNHG
MG776714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776715_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776578_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSASAVSTDHG
KM524341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875311_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JQ707476_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707478_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707479_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707480_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707481_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707482_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707484_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707485_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707487_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707488_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707489_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTRSSPSPSAVSSDHG
JQ707490_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707494_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707496_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707499_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707500_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707502_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707503_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707505_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707507_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707508_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSSSAVSSDHG
JN574723_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN040777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU963992_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963996_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963997_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964002_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963990_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963991_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963993_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963994_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963995_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963998_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963999_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964001_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964003_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KR014013_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPATHG
KR013852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013853_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013815_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFETLPSPSSSAVPADHG
KJ803774_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSTVPAAHG
KJ173395_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173317_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KC774309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSLSAVPADHG
KC774262_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSSSAVPADHG
KC163954_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGTLPSPSSSAVPADHG
JX661493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504541_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
JX429916_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KC774192_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
GQ377529_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGAIPSPSPSAVPADHG
GQ377527_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPSGSLPSPSSSAVPADHG
KJ173287_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ358158_HBx_C-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSRSLGTLPSPSSSAVPADHG
GQ358157_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRSVSGPLGVVPSPSPSAVPAAHG
FJ562255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ386662_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHG
FJ386597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
EU916210_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
KR013915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGQPVSGSLGTLPSPSSSAVPADHG
KR013919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSSSAVPANHG
EU589340_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589341_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589342_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ562276_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ787481_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU306690_HBx_P-C          MAARPCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
AY057947_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF326587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF182803_HBx_P-C          MAARMWCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871969_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB670261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB485808_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPTDHG
AB367410_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB362932_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774315_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB106895_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB050018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KC774310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSDSAVPADHG
KJ173291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KR013812_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFGTLPSPSSSAVPADHG
MK171413_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVIPTVNG
KP406170_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KP148317_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803820_HBx_P-B          MAARLCCQLDTARNVLCLRPVGAESRGRPLPGSLGALPPASPPAVPTDHG
KJ803768_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562312_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562262_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448627_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU859952_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
GQ331047_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
AB367395_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
JQ040144_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363281_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU306685_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306687_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306688_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306689_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306691_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
MK171452_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGDLPSPSFSAVPADHG
JN104440_HBx_P-C          VAARLCCKLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSSSTVPADHG
KJ803804_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPIGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ470887_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSLPAVPADHG
KF873530_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAEPRGRPVSGPLGDLXSPSSPAVPADHG
GQ161754_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904407_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFGAESCGRPFSGPLGDLSSSSLPAVPADHG
HM363609_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AM494691_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN182664_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFSSPSPSAVSSDHG
MN066389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAASSDHG
MG776781_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSADHG
MG776581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KU668439_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KT235621_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JQ032005_HBx_P-D          MAARLCCQLVPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
GU456643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSTDHG
AB270543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524346_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524351_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KT366465_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925364_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103283_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925378_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTLPSPSSSAVPTDHG
KF873520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
JQ040152_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESGGRPVSGPFGSLPSASSSAVPADHG
FJ023641_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
FJ023658_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
GQ855523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPPDHG
GQ855548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JN418500_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JQ801520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JQ801523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
MH488812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG826152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
MF674427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVLPTDHG
KX276788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148345_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KC774397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHG
KC774375_HBx_P-B          MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHG
JX870001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHG
JX661479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
JX429897_HBx_P-B          MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
DQ995805_HBx_P-B          MAARLCCQLDHARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MF925379_HBx_P-D          MAARLFCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPTVHG
JX661482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
EU939638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AB073839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
AB674431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MK818223_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
MK171603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK171403_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTSSPPVVPTDHG
MK171285_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488848_HBx_P-B          MAAGLCCQLDPARNVLCLRPVGAESRGRPLPGSLGALPPATPPGVPTDHG
MG571354_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGALPPASPPVVPTDHG
MF674420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
KY881866_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881864_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276812_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KX276777_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963955_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963952_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963951_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963950_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963949_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963948_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963947_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963946_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KM875418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM359440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803817_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ173423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ173422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ173421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ173420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KC774419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX504533_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
JQ801507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQR
JQ341838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
JQ341814_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHG
JQ040171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
GU451682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
EU547563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
X97850_HBx_P-B            MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPAVPTDHG
MK171613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
MK171292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488836_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MH488816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPRLPTDHG
MG571347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571338_HBx_P-B          MAARLCCQLDPARDVLCLRPVDDESRGRPLPGPLGALPPASPPVVPTDHG
MF674485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
KX276802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPGVPTDHG
KX276792_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276781_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964151_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964150_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964149_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964148_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964147_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964146_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964145_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964144_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964143_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964142_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964141_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964140_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964139_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP036970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM392072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213036_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774383_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507215_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707766_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707762_HBx_P-B          MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707753_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707746_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707745_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707740_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ341817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027329_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JQ027330_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803802_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803782_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
MK171638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSVVPTDHG
MK171396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGQPLPGPLGALPPASPPVVPTDHG
MH488856_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH488855_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH488853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488820_HBx_P-B          MAAWLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571351_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MG571331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVPTDHG
KX276830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVSTDHG
KX276811_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
KJ803756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
X98077_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK818222_HBx_P-B          MAARLCCQLDPARDVXCLRPVGAESRGRPLPGPLGALPPASPPAVPTBHG
MK171649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
MK171587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171545_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH663473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
MH488842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MH488833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
MH488813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571376_HBx_P-B          MAARLYCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
MG571361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571353_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG372436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KY881865_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPVSPPVVPTDHG
KY881849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881833_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881830_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881828_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPPVPTDHG
KY470841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KX276829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPASPSAVPTDHG
KU964168_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964167_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964166_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964165_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964164_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964163_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964162_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964161_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964160_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964159_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964158_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964157_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964156_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964155_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964154_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU963853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148366_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148365_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148364_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148363_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148362_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148361_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148360_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148359_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148357_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148356_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148335_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148334_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148333_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148332_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148331_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148330_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148329_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALSPASPPVVPTDHG
KP148328_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148327_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148326_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148325_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148324_HBx_P-B          MAARLCCQLGPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148323_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148322_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148321_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148320_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148319_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148318_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148314_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KM875417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KM875416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KJ803763_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ410517_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173345_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC774415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHG
KC774412_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC315393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX869999_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX869998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
JX661478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504538_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX429908_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341827_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
JQ341822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHG
JQ341810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040157_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ040125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN827419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM153811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
HM011503_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF436923_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171501_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK171364_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHE
MH488826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH061283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPIVPTDHG
MG571368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPASPPVVPTDHG
MG571366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPTSPPVVPTDHG
MG571350_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MG571342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571333_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571328_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571324_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571322_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
MF674450_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674449_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MF674426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KX429647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276801_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276791_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KX276774_HBx_P-B          MAXRLCCQLDPARDVLCLRPVGAESRGRPLXGXLGALPPASPPVVPTDHG
JQ341800_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KX276818_HBx_P-B          MAARLCCQLDPARDVLCLRPXXAESRGRPLPGXLGALPPASPPAVPTDHG
KX276790_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTXHG
JX507213_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
KX276779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276804_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
HM011478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276806_HBx_P-B          MAARLCCQLDXARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963953_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963957_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963958_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963959_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
FN545841_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
MH580614_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580615_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580616_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580618_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580619_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580620_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580623_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580651_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
FN545842_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
KU736903_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915177_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPANHG
AM494690_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494693_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494697_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494701_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGALSSPSPSAVPADHG
AM494702_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494703_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494704_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494707_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494708_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494709_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494710_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494713_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494715_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494717_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594766_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363569_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363570_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363571_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363572_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363573_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KU736893_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736900_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736901_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736902_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
KU736905_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736906_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736907_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736908_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736910_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736911_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736912_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736913_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776403_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776512_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776678_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776737_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776798_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776799_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580617_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580628_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580630_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580644_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580650_HBx_P-E          MAARLCCQLDPARDVLCLRPVNAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507846_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507848_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X75657_HBx_P-E            MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594767_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPANHG
AM494705_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU679953_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KT003704_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPAPHG
KF873522_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
HQ700554_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGDLPSPSSSAVPANYG
HQ700532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HQ700519_HBx_P-RF-CB      MAARLCCQLDTTRDVLCLRPVGAESSGRSVSGPLGDLSSPSPPAVPADHG
HQ700500_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
FJ023667_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPFGDLPSPSPSAVPAVHG
EU833891_HBx_P-RF-GC      MAARLCCQLDHARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
AP011102_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGGLPSPSSSAVPADHG
KU736904_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X97849_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MN182670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MG776527_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF925391_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSADHG
MF925390_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
KY629634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ687530_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
JF754608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ477458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AB109476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF674430_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KP148560_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ173286_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF873516_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KC774333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774316_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPANHG
HQ700570_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700490_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700456_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPATHG
HQ700522_HBx_P-C          MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
HQ700543_HBx_P-C          MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
KU679948_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLAALPSPSSSAVPADHG
KU679944_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KJ470892_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSLPAVPADHG
HQ700536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700533_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700507_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
FR714490_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
FJ904444_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPADHG
FJ904408_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904404_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
AB105172_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGDLPSPTSSAVPANHG
MG776412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAISTDHG
JN664932_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN664918_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN642134_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB116266_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSSDHG
AB110075_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109475_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB078033_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB078032_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB078031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
MF925405_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925398_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925387_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925374_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925369_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
KR811747_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFSSAVPADHG
KR013856_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148545_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ410513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163964_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163963_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163962_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163955_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163948_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700502_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
HQ700476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
FJ023654_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KU679959_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
MN066390_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KU679952_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVXRPLGDLPSPSSPAVPADHG
KP288875_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KJ803798_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ647356_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ470890_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470888_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470886_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470884_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSLPAVPADHG
KF873534_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873533_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873524_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KF873517_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873515_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873513_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873511_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
JN642152_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642141_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700585_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700584_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700583_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700582_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700581_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700579_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700560_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700541_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700540_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700537_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700535_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700534_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700530_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPADHG
HQ700528_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HQ700525_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPAXHG
HQ700524_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700523_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPIGDLPSPSSSAVPADHG
HQ700509_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSLSAVPADHG
HQ700508_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
HQ700505_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPPGDLPSPSLPAVPADHG
HQ700503_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700501_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700497_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700493_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPANHG
FJ904447_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904437_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPADHG
FJ904414_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904405_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPANHG
FJ904403_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGDLSSSSLPAVPADHG
FJ904394_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ361772_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSPSAVPANHG
AF297619_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
AB188243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB033559_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HM363583_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363582_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
MG776600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KX423696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KJ470893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
FJ904422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
X75665_HBx_P-C            MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSLSAVPANHG
MK171315_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
MG826131_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MF674435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674429_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSPAVPADHG
KR811459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148512_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ803815_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ410504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGSLPSPSSSAVPADHG
KF873514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEPRGRPFSGPLGALPSPSSSAVPADHG
KC774325_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSRPFGTLPSPSPSAVPADHG
KC164089_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026888_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPADHG
JQ707773_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700521_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESGGRSVSGPLGDLPSPSPPTVPADHG
HQ700462_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPPSSAVPANHG
KX276857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
FJ904435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGDLSSSSLPAVPADHG
KU679949_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESRGRPFSGPLGALPSPSSSAVPADHG
KU679947_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KJ410518_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700555_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
KU679955_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPXSSAVPADHG
KU679950_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679946_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679941_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KU679939_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPPSSAVPADHG
KF873521_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KY629633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ341887_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPADHG
KU679940_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873535_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873523_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXVPSPSSSTVPADHG
HQ700518_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRSVGAESRGRPVSGPLGDLPSPSSPAVPADHG
GQ358155_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSSSSSAVPADHG
AP011103_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPAAHG
AB493847_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493840_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
AB493838_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493837_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPTGALPSPSSSAVPADHG
KU679960_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPPGDLPSPSSSTVPADHG
KU679937_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDXPSPSSSAVPAXHG
JQ341895_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341875_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
HQ700578_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGTLPSPSPSAVPANHG
HQ700572_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
KU679942_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
HQ700576_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDXPSPSXSAVPANHG
KF873519_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873518_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
HQ700557_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700485_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
KU679936_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HQ700577_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLXSPSXXAVPANHG
HQ700575_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLSSPSPSAVPANHG
KF873544_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KC163966_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163967_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163968_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163969_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163970_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163971_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163972_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163973_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163974_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163975_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163976_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163977_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163978_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163979_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AB120308_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB205126_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210822_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB267090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB471856_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB471857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103275_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHG
EF594773_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
GQ183471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183475_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHG
GQ183479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183485_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ924652_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN574729_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN664927_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
JQ687531_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSSDHG
KC875310_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679994_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679996_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679997_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679998_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524344_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KM524353_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524354_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KR905424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN642157_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP995100_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU939579_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
FJ899774_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
EU562215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562216_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562217_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPEPFGPLSSPSSSAVPADHG
GQ475338_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSTVPADHG
AF324347_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU439010_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014386_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014397_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026811_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026812_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026813_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026814_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026815_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB033550_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198078_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198079_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB198081_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198082_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
AB205124_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB222714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB299858_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB426467_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471851_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471853_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB640730_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB642100_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670247_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670267_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB222715_HBx_P-C          HAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
KC774214_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774334_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367412_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418555_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670249_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171303_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
AB033551_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAAHG
AB033553_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB033556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSSSAVPADHG
FJ386576_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY251137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
GQ377543_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774312_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT364752_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774431_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHG
KJ598778_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ787485_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ562273_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
EU939617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939560_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF326585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326586_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ377528_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ475311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPTDHG
JX429905_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSTVPTDHG
JX429917_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX504544_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774202_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774274_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPTDHG
KC774303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
KJ803800_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
AF325701_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670278_HBx_P-C          MAARMCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLPSPSSSAVPADHG
AB033552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB014364_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014377_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB014378_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPADHG
AB014394_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB111114_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367401_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367430_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPANHG
AB367435_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB642095_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB642097_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670238_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSTSAVPADHG
AB670242_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670256_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
HQ700529_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPLGDLPSPSPSAVPADHG
GQ475337_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475320_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ377628_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787487_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787483_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787482_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787479_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787439_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562325_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSISAVPADHG
FJ562304_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562269_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386672_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPFSGPFGPLSSPSASAVPANHG
FJ386592_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939642_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPIGSLPSPSSSAVPADHG
EU939568_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
DQ089795_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028298_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325700_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325199_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670304_HBx_P-C          MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670295_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670268_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670277_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475335_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
EU787435_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KU964226_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964225_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964223_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964220_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964217_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475356_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ872211_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB365451_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367427_HBx_P-C          MAARMCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU717218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562331_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
KF018208_HBx_P-D          MAARVCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KR013794_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KC774359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700564_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
AB670258_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964028_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964049_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964050_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964051_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964052_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964053_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964054_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964055_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964056_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964057_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964058_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964059_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964060_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964061_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964062_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964063_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
FJ562332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HM750132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774439_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774223_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774241_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB205121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU522067_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ787475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB555499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC814918_HBx_P-B          MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026883_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ386668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ361535_HBx_P-B          MAARLCCQLDPARDVLCLHPVSAESRGRPLSGPLGALPPTSPSVVPTDHG
KC510659_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510646_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510653_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC774369_HBx_P-B          MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHG
KC814890_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814917_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPTSPPAVPTDHG
MH488811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPIVPTDHG
MG571326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571329_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774382_HBx_P-B          MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPG
JX504532_HBx_P-B          MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHG
GQ358144_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHG
AB073850_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHG
GQ924651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ924654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ358146_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ358147_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ924645_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHG
AB219426_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219429_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219427_HBx_P-B          MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803772_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPSAVSTDNG
MK171366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDYG
MH488845_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
JX661470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYG
GQ358145_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHG
EU881997_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
D23678_HBx_P-B            MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHG
AY033072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY033073_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AB931168_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AB931169_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AB073849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAAPPSAVPPDHG
KP148369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KP148451_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KC814875_HBx_P-B          FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
GQ924656_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ475340_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
EU939661_HBx_P-B          MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AB073856_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
KC510652_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510644_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
FJ032342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
GU815723_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ386674_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032344_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF925392_HBx_P-RF-DB      MAARLFHSLAAARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK171599_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674410_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVSTDHG
KY881946_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPSAVPTDHG
KY881945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881947_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY629636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGVESRRRPLPGPLGALPTASPSAVPTNHG
KC774418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHG
KC774416_HBx_P-B          MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KC510651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510648_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
JQ341798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
JQ040173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
GU815732_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHG
GU815726_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815724_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHG
GQ855529_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815722_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815725_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815728_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815730_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815731_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815740_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815741_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815742_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815743_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815744_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815745_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815746_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ377561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562303_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386648_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHG
FJ023638_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHG
EU881998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU589335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU570075_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHG
EF134946_HBx_P-B          MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993704_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448621_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY800391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
AY800392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
AY217361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
AY167094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY596104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AJ627225_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
JQ341823_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHG
AF282918_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
X97851_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AF282917_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHG
AB900108_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB368295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHG
AB302942_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302943_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB241116_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB241117_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB010289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
LC349879_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
KX276828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
JQ341843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHG
D00329_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB642101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB828708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
MG571346_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881839_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KX429622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KU964301_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812011_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KP148440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
KP148344_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDYG
KP148339_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KM875420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ790200_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KC510657_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHG
KC510656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
JX661483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYG
JQ027311_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHG
HQ700548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHG
GU815727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRG
GQ924624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHG
GQ377638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
GQ358143_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
FJ032354_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHG
EU939633_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EF134945_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHG
DQ993700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
AY800389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AY217355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHG
AF121247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHG
AB900105_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB302945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHG
AB073832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHG
AB205119_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB246340_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB365445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB642094_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
AP011084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHG
AP011096_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY163869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY163870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY167089_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
AY596112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
DQ377158_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ448620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ448622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386646_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPADHG
MK171632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPPDHG
MK171542_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAAPPVVPTDHG
MK171343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGPESRGRPLPGPLGALPPASPPVVPTDHG
MF674440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881955_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881845_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KY881823_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KP148426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDRG
KP148338_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ803825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPASPHLVPTDHG
KJ803796_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KJ173351_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYG
KC774362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPG
JQ429081_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
HQ700546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
GU815770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815685_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ924640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU939634_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
DQ993696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900107_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHG
AB073844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHG
EU939629_HBx_P-RF-BC      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVLPTDHG
MK171409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
MK171306_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVLPTDHG
MH488851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488843_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVSTDHG
MG571373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571371_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
MG571370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674456_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPATPSAVPTDHG
MF674424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674382_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
M54923_HBx_P-B            MAARLCCQLDPARDVLCLRSVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349868_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPADHG
KY881951_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881950_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881949_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881948_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881902_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881863_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881860_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881837_HBx_P-B          MTARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KX765856_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPGIPTDHG
KX429630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPXSPSXVPTDHG
KX276783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KU964264_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964261_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964260_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964259_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964258_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964257_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964137_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964097_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964096_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KP148372_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KJ410502_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173384_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHG
KJ173355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173354_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KC774390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHG
KC510660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC510654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC163809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHG
JX661481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHG
JQ707758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
JQ341833_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHG
HM011476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
HM011470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
FJ562236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHG
FJ023636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU882004_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882003_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU796071_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU139543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHG
EF473977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
DQ995804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AP011094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AB555498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB073843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB073831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHG
KP148337_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
HQ684848_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGVLPPASPPSLPTDHG
MK171372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052964_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MH488832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF674470_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPADHG
MF059700_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059694_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059620_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
LC416037_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
LC349877_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KY881856_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881843_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY629635_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KX429631_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276817_HBx_P-B          MAARLCCQLDPARBVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KU964302_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964300_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964299_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964296_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964294_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964293_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964288_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964287_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148435_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148429_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148394_HBx_P-B          MAARLCCQLDPARYVLCLRPVGAESRGQPLPGPLGALPPASPSAVPTDHG
KP148392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148383_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAGSRGRPLPGPLGALPPASPSAVPTDHG
KP148349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148346_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADYG
KP148342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDYG
KP148341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148340_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KM213032_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ843165_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ173353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYG
KJ173340_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KJ173339_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KC774395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC163815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026879_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHG
JQ801474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707757_HBx_P-B          MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ429079_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHG
HM011471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HM011467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
GU815783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815782_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815780_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815778_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815777_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815776_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815774_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815772_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815771_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815769_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815768_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815767_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815766_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815765_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815762_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815761_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815760_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815757_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815754_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815753_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815751_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815750_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815749_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815748_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815747_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815729_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815721_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815720_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815719_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815718_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815717_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815716_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815715_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815713_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815692_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
GU815691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU357842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHG
GQ924637_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924631_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
FJ751769_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562321_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ562253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562234_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
FJ562231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ518811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
FJ386684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ386683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ023633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHG
EU939673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939636_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU882002_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU796068_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796067_HBx_P-B          MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU487257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU043345_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043344_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043342_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473973_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EF473972_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
DQ993709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AY206375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK171555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171420_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171304_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHPVPTDHG
MF674465_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPAVPTDHG
MF674464_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674446_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059719_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059609_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
LC349870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC349869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881899_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881862_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KY881842_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881841_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881838_HBx_P-B          MAARLYCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLVPTDHG
KY881836_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881834_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881831_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881827_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881826_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881824_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881822_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881820_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY470961_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY470960_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY470953_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KX276823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276800_HBx_P-B          MAARLXCQLDXARBVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276771_HBx_P-B          MAARLCCQLDPARDVLCLRXVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964286_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964285_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964282_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964281_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964280_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964279_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964278_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964277_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964276_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964275_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964274_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964272_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KP148406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KM213034_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803824_HBx_P-B          MAARLCCQLDPSRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ410500_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ173410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
KC774394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHG
KC774376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHG
KC492740_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC492739_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JX661473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHG
JX429900_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
JX429899_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHG
JQ801471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ993687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
MF925402_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925382_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925370_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803803_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803778_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173358_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
EU939631_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660227_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF233236_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171592_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171536_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171523_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
MK171499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171486_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MK171482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MK171448_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH932712_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPSAVPTDHG
MH488846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488841_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG826153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MG571363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MG571358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MG571336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MG571327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MF674509_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSTVPTDHG
MF674506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674503_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674488_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPVPTDHG
MF674460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MF674421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MF674384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF621878_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059732_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059731_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059730_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059729_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059728_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059726_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059724_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059723_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059722_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059721_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059720_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059718_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059717_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059716_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059715_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059714_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059713_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059692_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059690_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059685_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059671_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059665_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059662_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059659_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059657_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059653_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059645_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059637_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059631_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059618_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059615_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059607_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059604_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059599_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059597_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059596_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059594_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059593_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059592_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059590_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059586_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059585_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059580_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059577_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059572_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059565_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059564_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059560_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059557_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF059553_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059550_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059549_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059545_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059544_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059542_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059541_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059540_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059539_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059538_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059537_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059536_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059535_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059534_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059533_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059532_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059531_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059530_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059529_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059527_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059526_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059524_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059523_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059522_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059521_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059520_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059519_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059518_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059517_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059514_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059513_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059511_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059510_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059509_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059508_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059505_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059504_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059503_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059502_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059501_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059500_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059493_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059492_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059491_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059489_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059488_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059486_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059472_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059468_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059465_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059464_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059463_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059462_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059458_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059457_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059456_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059454_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059453_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059450_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059449_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059448_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059447_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059446_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059444_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059443_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059442_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059435_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059434_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059432_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059431_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059429_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059428_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPPASPPVVPTDHG
MF059417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059412_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
LC349875_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349873_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881914_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881913_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881912_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881911_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881910_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881909_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881908_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881907_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881906_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881905_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881904_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881903_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881901_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881900_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881898_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881897_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881896_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881895_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881894_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881893_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881868_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881867_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881861_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881859_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881858_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881857_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881855_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881854_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881852_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881851_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881848_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881847_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881846_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881844_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881829_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881825_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY470962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KX429651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
KX429648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX429627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPTDHG
KX429621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPSAVPTDHG
KX429616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX276809_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KX276797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276778_HBx_P-B          MAARLCCQLDTTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276776_HBx_P-B          MAARLXCQLDXXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276772_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KX276770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KU964397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964252_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964136_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964135_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964134_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964133_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964132_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964131_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964130_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964129_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964128_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964127_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964126_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964124_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964123_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964122_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964119_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964118_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964116_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964114_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964113_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964109_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964108_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964092_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964091_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964090_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964089_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964088_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964087_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964086_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964083_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964082_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964081_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964080_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964079_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963988_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963987_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963986_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963985_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963984_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963983_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963982_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963981_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963980_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963979_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963978_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963976_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963975_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963973_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963972_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963969_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963968_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963967_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963966_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963965_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963964_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963963_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963961_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963960_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963855_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963818_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963806_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148580_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPPPGPLGALPPASPSAVPTDHG
KP148374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ173417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173412_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173388_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173387_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173362_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173361_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KC774417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774413_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC774410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774406_HBx_P-B          MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHG
KC774403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHG
KC774401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774392_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KC774388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774387_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC774381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KC774380_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
KC774378_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC774366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
KC774365_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163818_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163814_HBx_P-B          MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KC163812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX978431_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
JX661476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX661474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661472_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX504543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
JX429910_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX429901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707767_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707765_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707763_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707761_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707760_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707754_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707751_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707750_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707749_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707748_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707747_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707744_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHG
JQ707743_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707742_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707741_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ688405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ429080_HBx_P-B          MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ341845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ341826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
JQ341812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHG
JQ341799_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AP011087_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
HM011490_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHG
KX276827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPXSPXAVPTDHG
AB642093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
JQ027334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
KX765854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
AB073823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KX276786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTXHG
JQ341850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHG
DQ993683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX276820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ040170_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KX276775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
JQ341811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHG
JQ341825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173279_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173280_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KU964098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964099_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964105_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964107_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964262_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964263_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964265_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964266_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964267_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964268_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964269_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964270_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964271_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY881952_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881953_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KY881957_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881958_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB367428_HBx_P-C          MAARVCCQLDPARDVLCLRPIGVESRGRPVSGPFGTLPSPSSPAVPADHG
KC814883_HBx_P-B          MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHG
AB976562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTYHG
AB104890_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB104891_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ377567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHG
AB214516_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK052965_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPPVVPTDYG
KC814873_HBx_P-B          MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHG
KJ803773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
MG571341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPLVPTDHG
AB031265_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
JQ272888_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
AB073825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
AF479684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHG
AB246339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AB287328_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121243_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
FJ904406_HBx_P-RF-DE      MAARMCCQLDPARDVLCLRPVGAESCGRPFSGPLGDISSPSLPAVPTDHG
FJ023632_HBx_P-B          MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
FJ023631_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHG
MF674453_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
KJ803816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
AF121246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
GQ924605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
KC774364_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
KC774178_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
MG571365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTNHG
MG571344_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
MF674391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPFVPTDHG
HM011466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
JQ341815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
MK171468_HBx_P-B          MAARLCCQLDPARDVLCLRPVGXESRGRPLPGPLGAVPPASPPVVPTIHG
FJ755833_HBx_P-B          GLSRLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924607_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ801514_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171365_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562240_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173350_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173349_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939665_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377550_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171272_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377635_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803791_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939676_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AB287323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287320_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHG
AB287321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
AB287325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB073855_HBx_P-B          MAARMCCQLDTARDVLCLRPVGAESCGRPLSGPLGALPPASPSAVPTDHG
AB073853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDG
HM011474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHG
HM011477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHG
AB713530_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB106884_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHG
HM011487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
GQ924628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPAASPSAVPTDHG
AB713529_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713527_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB115551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB033555_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHG
EU564826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU939669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
FJ562311_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AY206373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB073836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522073_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522075_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011482_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787476_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHG
FJ386615_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
AY167102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHG
AB900110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522074_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562260_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU919171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ386680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU487256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
EU660224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
GQ377542_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
DQ993698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JX429902_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX026886_HBx_P-B          MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
KX276782_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
GQ377606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
GQ377566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHG
DQ993694_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHG
AY217362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF461360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027313_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011504_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
GQ377643_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899791_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ899790_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377537_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562296_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU919172_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU939639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939674_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ518812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ032358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AF100309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHG
AY217368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ032357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ562219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
AP011089_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHG
AB362933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB300370_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHG
AY206390_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
AY238972_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
MF674439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279268_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279269_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279270_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279271_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279272_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP659220_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
HQ700549_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
AY283777_HBx_P-B          MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AP011092_HBx_P-B          MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011088_HBx_P-B          MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB900098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB219428_HBx_C-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
AB073852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB010290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHG
AB900106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHG
AB713528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
FJ349236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
AB287326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011090_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011091_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473976_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
FJ023637_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358137_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358140_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358141_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP148452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148453_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148456_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPSSPSAVPTDHG
AB073858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ993680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MG571348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148458_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
GQ358136_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D23679_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHG
AB073848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
HM011496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349874_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429082_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ803784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349878_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHG
AP011086_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900097_HBx_P-B          MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX765841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
HM011492_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
GQ924639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
GQ924617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
FJ023635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
D50522_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50521_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB713531_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB493835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
AB073838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925384_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPASPSAVPTDHG
LC349872_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTNHG
JQ027316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHG
GQ924638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
EU660233_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660232_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660230_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900102_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB900111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AP011085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ855689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
KJ173401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
KJ173402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
MF674448_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLRALPPAPPSAVPTDHG
AB073842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHG
KU234318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
JQ341824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHG
GQ855526_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHG
MF674492_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPAPPSAVSSDHG
MF674462_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPALPSAVPTDHG
AB031266_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
AB117759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPAPPSAVPTDHG
DQ993686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF925360_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674511_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674505_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674493_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674491_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPEPPSAVPTDHG
MF674455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674447_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674443_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MF674437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341840_HBx_P-B          MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674495_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB205122_HBx_P-B          MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB031267_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
AB212625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674432_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674500_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRSLPGPLGALPPAPPSAVPTDHG
MF674515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
MF674445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674434_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSAVPTDHG
MF674507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB212626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB073835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
JQ341848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674513_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674510_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674466_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674451_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPAPPSPVPTDHG
MF674423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674401_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPLSAVPTDHG
MF674393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPAPPSAVPTDHG
MF674387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHG
DQ993682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
KP659245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB073854_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073857_HBx_P-B          MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP659234_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
JN792901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
JN792902_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
EU330994_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
DQ463791_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHG
AB287324_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGAPPPASPSAVPTDHG
AB287322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
LC349871_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPASPSAVQTDHG
AB287314_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287317_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EU330989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330990_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330992_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330995_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330996_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330997_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330999_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331000_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
KP659219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659235_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659237_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659246_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287319_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659223_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659221_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
KP659255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVXTDHG
KP659251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659252_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
DQ463798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
JN792899_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
KP659250_HBx_P-B          MAARLCCQLDPARDFLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
EU579441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ463795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
DQ463793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463796_HBx_P-B          MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463790_HBx_P-B          MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792900_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463792_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463799_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
JN792894_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHG
DQ463800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792897_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792898_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
KP148419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP148427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP659249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALPPXSPSAVPTDHG
MF674508_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPAPPSAVPANHG
KJ173373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
DQ463789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
GQ924635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
JN792895_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
JN792896_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
JN792893_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
HM011499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
KX276858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPXVPADHG
MG571340_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPIVPADHG
DQ993685_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHG
FJ023634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHG
AB073846_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHG
AB073851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
GQ377525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU306700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
EU306708_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875427_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
GQ924632_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341818_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774396_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM392083_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875426_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ448625_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
AY167093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNG
KY881784_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881800_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881795_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040147_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881781_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881782_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881783_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881786_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881787_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881788_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881789_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881790_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881791_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881793_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881794_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881796_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881797_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881798_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881799_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881801_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881808_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881850_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881785_HBx_P-B          MPARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815574_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815577_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217357_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217358_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB195933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195934_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195935_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB073824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040128_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
DQ995802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
AY167098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY596105_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AP011095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
FJ386608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
FJ562257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHG
FJ562289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHG
GQ377630_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPCVPTDHG
FJ386583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHG
AY220697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206383_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU919175_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919176_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ899785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
EU939672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899786_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHG
GU815653_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
KY881780_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964115_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964117_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JF412801_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924653_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHG
FJ562322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
FJ386610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDG
EU570069_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLG
EU570071_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLG
EU439021_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439018_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU350409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU305547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EF473974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
AY518556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN406371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU434372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
FJ386660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
DQ448624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
KX276796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
MK171525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPHVPTDHG
MK171427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTIHG
KM213035_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507210_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JQ341844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
JQ040138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHG
JQ341797_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHG
JF899335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815674_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
GU815668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815665_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815662_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815659_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815657_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815652_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815645_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
GU815642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815637_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815631_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815618_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815565_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815564_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815560_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815557_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815553_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815550_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815549_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU434373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
GQ924603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855522_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787444_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562237_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386669_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHG
FJ386582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU595031_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439023_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439022_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439020_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU305548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EF473975_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ975271_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHG
DQ448626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
D00330_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY766463_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
AY596111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AY310322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY293309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
AY167097_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF100308_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHG
AB471855_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB471854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB300364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB287329_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073837_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHG
AB073826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHG
AB073822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ904357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939671_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU939678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
FJ386675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562222_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040169_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPIVPTDHG
JQ027315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHG
DQ995803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562259_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHG
AB675676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHG
MH488819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY417926_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPSNHG
KR232337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPTASPPVVPADHG
GQ358148_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
HM011484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AF121251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
GU815605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
D00331_HBx_C-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB900104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB287327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
KR152339_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
AB033554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
KP148459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
JQ341793_HBx_P-B          MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
JF436921_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ358150_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
GQ358149_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHG
KJ173297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
EF494381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815583_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHG
GU815584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815585_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815586_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815590_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815593_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815594_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815596_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815597_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815599_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815604_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815607_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815609_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MG571356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
KP148457_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPHGALPPASPSAVPTDHG
KC774405_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHG
JQ801524_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
JQ341819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
MK818225_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KY881869_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881835_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPLVPTDHG
KY881779_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881778_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881761_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881760_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881759_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881757_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881756_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881753_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881752_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881747_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881746_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881745_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881741_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881740_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881735_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881734_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881733_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881732_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881731_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881730_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881729_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881728_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881727_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881726_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881725_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881724_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881723_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881722_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881721_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KX276822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPPAVPTDHG
JQ341808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHG
MK171374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK171280_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPLVPTDHG
MK075117_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
HM011473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHG
KC774367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596109_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
EU158263_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHG
GQ358138_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHG
GQ358151_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ358152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
KC774433_HBx_P-RF-DC      MAGRMGGQLDPARDVLCLRPVGGESRGRPFPGPFGFLRSPSSSAVPPDPG
KC774264_HBx_P-C          MDARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALRSPSSFAVPADHG
KC774292_HBx_P-C          MDARLCSQLDPARAILYLRPVGAESRGRPVSGQFGPLPSLFASAVPANHG
KC774191_HBx_P-C          MDDRVCCQLDPARDVLCLRPVGVESRGRPVSGPFGAFPSPSSFAVPADHG
KR811467_HBx_P-C          MDARLCCQLBPARDVLCLRPFGAESRGRPISGPFGNLPSPSSSAXPTDHG
KC814901_HBx_P-C          MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939546_HBx_P-C          MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSFFAVPANLG
FJ562247_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHG
FJ562302_HBx_P-RF-CB      MAARMCCQLDPALDVLCLRPVSAESRGRSLSGRFGTLPSPCSSAVPADHG
EU939547_HBx_P-RF-CB      MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLSSPSSFAVPADLG
KJ173320_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
KJ173322_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
JN040750_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KC774203_HBx_P-C          MDVRVCCQVDRARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
JN418565_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
DQ536414_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536413_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536410_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536412_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536411_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
KJ598641_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598660_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598642_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
MK171534_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGPLPSPSSSAVPAVNG
KU964015_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
KC774265_HBx_P-C          MAARMCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSFAVPADHG
KC774197_HBx_P-C          MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPCGALPSPCSSAVPADRG
FJ562310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPTDHG
AB111113_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB555497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
AB555500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
JF436922_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHG
AY817510_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGSLPSPSSSAVPAAHG
JN257165_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
JN257166_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
KR013823_HBx_P-C          MAARLCCQLDPARDVLCLRPAGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429914_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPADNG
FJ562307_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGPLSSPSASAVPADHG
EU939584_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367409_HBx_P-C          MAARVCCQLDPAGDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
KC163996_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163994_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVAGPFGTPPSPSSSAVPADNG
KC163985_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163981_HBx_P-C          MAARVCCRMDPARDVLCLRPVGAESRGRPVAGPFGTPSSPSSSAVPADNG
KC163982_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163983_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPANNG
KC163986_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163987_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163988_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163990_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163991_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163992_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163993_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163995_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163997_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164000_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164003_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164005_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164006_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164007_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164008_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164009_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164010_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164011_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164013_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164014_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164015_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164016_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164017_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164019_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164020_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164021_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164022_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164024_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164025_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164026_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164027_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164028_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164029_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164030_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164033_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164004_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164023_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
GQ377595_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU239220_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KX357622_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
MK171513_HBx_P-C          MAARVCCQLDPARDVLCLRPVGPESRGRPVARPLGTLPSPSVSAVPADHG
KM875412_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
KJ598721_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964242_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
HQ700569_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPFAVPANHG
FJ386611_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB115418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPFGPLSSPSSSAVPADHG
KC163998_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADNG
EU871983_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871981_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871999_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AY817515_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774457_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLG
AB049609_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LT623851_HBx_P-E          MAARLCCQLDPARDVLCLRPVXTESCGRPVPGSLGDLSSPSPSAVPAXHG
HM750152_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
AB674423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
AB330367_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSSDHG
EU787443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MH488822_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488821_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MG893560_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
KY881915_HBx_P-C          MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881937_HBx_P-C          MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY363284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
KT284756_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVEGPFGTLPSPSSSAVPADHG
KR811728_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADLG
KJ598748_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598742_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598750_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598754_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPAAHG
KJ598635_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598646_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598659_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KC875262_HBx_P-C          MAARVCCQLDPAGDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814900_HBx_P-C          MAARVCCQLDDARDVVCLRAVGAESRGRPVSGPFGTLPSPSSSAVPADQG
KC814882_HBx_P-C          MAARVCCQLVLMPFVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814871_HBx_P-C          KAARVCCQLNSAGDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814863_HBx_P-C          MAARLCCQLGLARDVLCLRPVGAESRGRPVSGPFGLLPSPSSSAVPADHG
KC774329_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVSSPSSSAVPADHG
KC774229_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSSSAVPADHG
KC774181_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGSFGSLPSPSASAVPADHG
JX026878_HBx_P-C          MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGGIPSPASSAVPADHG
JQ027322_HBx_P-C          MAARXCCQLDTARDVLCLRPVGAESRGRPVAGPSGALPSPSSSAVPADHG
JN418498_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
HQ700517_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTVPSPSSSAVPTDHG
HQ700506_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGALPSPPSSAVPADHG
GQ924620_HBx_C-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
FJ386616_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ386605_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPASAVPADHG
FJ032360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
EU939619_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
EU939578_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU939577_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU916226_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
EU916223_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU916222_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU306725_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439005_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF494377_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
DQ980551_HBx_P-C          MAARMCYQLDPARDVLCQRPVGAESRGRPVSGPFGALPSPSYSAVPADHG
DQ922650_HBx_P-C          MAARMCCQLDPARDVLCLRPVRSESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089802_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVPRPFGPLSSPSTSAVPADHG
D23684_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFRSLPSPSSSAVPADHG
KT284758_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRPLSSPSSSAVPADHG
AY028593_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHG
AF384372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
AF286594_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AF223954_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341857_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF182802_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB900113_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
AB670305_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPXSGPFGPLPSPSSSAVPADHG
AB670270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPSSSAVPADHG
EU939540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
GQ377563_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSLSSSAVPADHG
AB670269_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPSDHG
AB205123_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGAIPSPSSSAVPADHG
AB202071_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB202072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB113879_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSAAAVPADHG
AB049610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
AB014387_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGHLSSPSSSAVPANHG
AB367802_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AB014368_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB014372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB014396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ298162_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KF873527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873528_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873525_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGXXPSPSPSAVPADHG
KF873526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873529_HBx_P-C          MAAXLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
AB195949_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089768_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939653_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSASAVPANHG
FJ386631_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386652_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
JQ040158_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
MK171505_HBx_P-C          MAARXCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSSSAVPADHG
KC774499_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774497_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KC774430_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPASSAVPANHG
KC774422_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVPSPSTSAVPANLG
KC774349_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSVESRGRPVSGPFGTLPSPSSSAVPAYHG
KC774222_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPTDHG
KC774188_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPAAHG
JF828935_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828934_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GU357843_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377596_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562317_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPSGPLPSPSSSAVPADHG
EU939620_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU939589_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSDSAVPAAHG
EU872014_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AY862865_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY123041_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSLAFSAVPADHG
MK171641_HBx_P-C          MAARVCCQLDLARDVLCLRPVSAESRGRPVSGPFEPLPSPSSSAVPADHG
MK171630_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171627_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSASAVPTDHG
MK171531_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVARPFGALPSPSPSAVPADHG
MK171520_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALSSPSSSAVPADHG
MK171517_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLPSPSSSAVPAAHG
MK171341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSASAVPADHG
MK171322_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHG
MK171320_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPTSSAVPADHG
MG893558_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MF059688_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KY882000_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAIPANHG
KY881968_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881967_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANRG
KY881961_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881959_HBx_P-C          MAARVCCQLDPARNVLCLRPVNTESRERPVSGPFGTLPSPSSSAVPANHG
KY881930_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881919_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881814_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881811_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470927_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFESLPSPSSSAVPADHG
KY363257_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGPLPSPSCSAVPADHG
KU964004_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGNLPSPSSSAVPADHG
KU964011_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KU964012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964013_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964016_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KU964017_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964019_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KT284755_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KT284753_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFRALPSPSSSAVPADHG
KR013877_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013846_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013786_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KF214670_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KC875263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814912_HBx_P-C          MAARVCCQLDPARECLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774185_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
JX504545_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
JX429918_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSYSAVPTDHG
JN104432_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
GQ475322_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPAVHG
GQ377576_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ377518_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899789_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRSVSGPFGALSSPSSSAVPADHG
FJ899765_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ787445_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562285_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
FJ562238_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562220_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSASTVPADHG
GQ475315_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386653_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386618_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386612_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSFSAVPADHG
FJ386589_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAEPSGRPVSGPFGPLSSPSSSAVPADHG
FJ032346_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADLG
FJ032331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSSSAVPADHG
FJ899788_HBx_P-C          MAARVCCQLDPARDVFCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU916225_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHR
EU916211_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916212_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916213_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916214_HBx_P-C          MAARVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HM750141_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPADHG
EU522069_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439014_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF536066_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPGDHG
DQ377160_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVLADHG
AY641559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AF411412_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTFPSPSSSAVPADHG
AB900099_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSSSAVPADHG
AB670301_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367429_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D23682_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
DQ986375_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSVGALPSPSSSAVPADHG
EU939573_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPADHG
FJ562299_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
KC774306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLPSPSPSAVPADHG
KC774447_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHLG
GQ377626_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPTDHG
EU939627_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY236161_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MG776520_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
AB270541_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK171564_HBx_P-C          MAARMCCQLDTARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRSVPGPFGDLPSPSLSAVPADHG
MK171496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPADHG
MK171494_HBx_P-C          MAARMCCQLDTARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAVNG
MK171471_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSATAVPANHG
MK171353_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171317_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MH488839_HBx_P-C          MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSVVPADHG
MG826129_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MG826128_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
KY881806_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470929_HBx_P-C          MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KY022423_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
KX429625_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
KR013863_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013811_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013789_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ803777_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KJ598655_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598637_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ410514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410508_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPAVNG
KC814908_HBx_P-C          WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814897_HBx_P-C          LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814888_HBx_P-C          IGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KC814874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814866_HBx_P-C          MAARVCCQLDSMREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774335_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPIGDLPSPSTSAVPAEHG
KC774194_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC163947_HBx_P-C          MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC163890_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPPPSSSAVPADHG
KC163886_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163875_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADYG
KC163869_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163868_HBx_P-C          MAARMCCQLDPARDVLCLRPVSPESRGRPVSGPFGTLPSPSSSAVPADHG
KC163866_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVLGPFGTLPSPSSSAVPADHG
KC163865_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ040162_HBx_P-C          MAARMCCQLDPARDVLSLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN418539_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
JN418518_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418504_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN104435_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828925_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESCGRPLSGPFGPLPSPSSSAVPADHG
HM750136_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGAFGDLPSPSSSAVPADHG
GQ475333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
FJ562241_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023648_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSASAVPTDHG
EU939556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
EU439009_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF182805_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB697502_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB014362_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB014374_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB014381_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
AB014392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014399_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB042283_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB042284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB104892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AB111112_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111115_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111116_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111117_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111118_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB182589_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195936_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195938_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195942_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195943_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195944_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195945_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195952_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB246345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB300361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367392_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367394_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367398_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367408_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367418_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367425_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB367432_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB367433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
AB670241_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670252_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU589336_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB014398_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198083_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670287_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHG
AB670294_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHG
AB697500_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AY251141_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089801_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
EU916224_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ032334_HBx_P-C          MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032359_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ032361_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377514_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377517_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
GQ475321_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JF899336_HBx_P-C          MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104433_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KC774206_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774254_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774256_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774320_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173283_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173284_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173327_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013792_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPATHG
KR013795_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KR013796_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KU964020_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964021_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964022_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964023_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964024_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964025_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964026_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964027_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964029_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964030_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964031_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964032_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964033_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
EU871971_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
EU871972_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
JN418558_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562271_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KM875422_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSFSAVPADHG
FJ562229_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU871986_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AB642096_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPFGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195957_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195956_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171628_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171616_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171464_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVXGPLGDLPXPSSPAVPXDHG
MK171401_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
MK171379_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MK171267_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAIPTDHG
MG826137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279276_HBx_P-C          MAARLCYQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY470937_HBx_P-C          MAARPCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KX276839_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KU964214_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPISSPSSSAVPADHG
KU964035_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014060_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014055_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014005_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013868_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013864_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013826_HBx_P-C          MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM213037_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803793_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
KJ598687_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598645_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598644_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598640_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598638_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598636_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ173328_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875269_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPADHG
KC774286_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPANHG
KC774283_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC163956_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163867_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPIGTLPSPSSSAVPTDHG
JX661495_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSPSAVPADHG
JX661491_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661490_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429909_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
JX429903_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLETLPSPSSSAVPADHG
JQ801500_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JF828937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM011497_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
GQ475309_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ787461_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSDSAVPADHG
FJ562228_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
EU939553_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
DQ377161_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY641561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
AB250109_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
AB014395_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KC774492_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
FJ562227_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ732168_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPACHG
KU519422_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSFSAVPAAHG
KT991423_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991421_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
KT991420_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991419_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991417_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KC774498_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774495_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774487_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774486_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSAFAVPADHG
KC774481_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
KC774476_HBx_P-RF-DC      MAGRVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774474_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774458_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774453_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774425_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPAAHG
KC774344_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KC774341_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774332_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774323_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPFGTLPSPSPSAVPADHG
KC774201_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774198_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
JX661498_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
JX504540_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
JF828938_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828936_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828933_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF436919_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ377560_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ377544_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGSESRGRPVSRPFGTLPSPSASAVPAAHG
GQ377522_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
GQ377516_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSASAVPADHG
FJ562328_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562314_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
FJ562287_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
FJ562278_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
FJ386635_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
FJ386593_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPPDHG
EU939668_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTVPSPSSSAVPADHG
EU939630_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939621_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
EU871997_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
EU787434_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
EU589339_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ478897_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478886_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPPSSAVPANHG
AY862866_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY123424_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
AB674504_HBx_P-RF-DC      MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195941_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195940_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195939_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB033557_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MG776530_HBx_P-D          MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776529_HBx_P-D          MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018210_HBx_P-D          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK628732_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171639_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171637_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGTFGSLPSPSSSAVPAAHG
MK171623_HBx_P-C          MAARVCCQLDPARDVLCLRPVDAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171602_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSPPSSSAVPADHG
MK171586_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171575_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSPSAVPADHG
MK171540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSXSAVPADHG
MK171493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSLSAVPADHG
MK171489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGSLPSPSASAVPADHG
MK171463_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
MK171454_HBx_P-C          MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171453_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSRPLGALPSPSPSAVPADHG
MK171440_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK171431_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
MK171425_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171388_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
MK171384_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171382_HBx_P-C          MAARVCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSTSAVPADHG
MK171351_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPANHG
MK171350_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPSSAVPADHG
MK171347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171339_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXXXPFGPLSSPSASAVPADHG
MK171325_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPLGTLSSPSASAVPADHG
MK171316_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHR
MK171305_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGTFGTLPSSSSSAVPADHG
MK171299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
MH891502_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MG826140_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MG826124_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTVPSPSSSAVPADHG
MG571359_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
LC373512_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
LC373511_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
LC318703_HBx_P-C          MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSSSAVPANHG
KY881999_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881998_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881996_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881995_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881993_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADRG
KY881992_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881987_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881986_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881985_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881983_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881982_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881978_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881977_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881976_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881975_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881973_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881970_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881969_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881965_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881964_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881963_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881943_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881942_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881941_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881940_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881939_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881938_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881936_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881935_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881934_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881933_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881932_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881931_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881929_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881928_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881927_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881926_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881925_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881924_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881923_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881922_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881921_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881920_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881918_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881917_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881883_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881882_HBx_P-C          MAARVCCQLGPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881877_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881817_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVAGPLGTLPSPSSSAVPADHG
KY881813_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPLSGPLGTLPSPSSSAVPADHG
KY881812_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881805_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881804_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881803_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470934_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470933_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470930_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470926_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470925_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470887_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470882_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470877_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470875_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY363279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFPGPFGPLPSPSTSAVPADHG
KY363278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFPGPFGPLPSPSTSAVPADHG
KY363274_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363267_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363254_HBx_P-C          MAARVCCQLDPVRGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPVNHG
KX765853_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765820_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
KX276838_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964360_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964330_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964329_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964328_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964325_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964320_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964198_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964197_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964196_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964195_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964194_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964193_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964188_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964187_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964186_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964185_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964176_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPFSGPFGALPSPSSSAVPADHG
KU964064_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964048_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964047_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964046_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964045_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964044_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964043_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964042_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964041_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964040_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964039_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964038_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964037_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964036_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964034_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963882_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963881_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963879_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963877_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT364751_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSPSAVPADHG
KR811737_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811732_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014099_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014098_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014049_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014048_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014041_HBx_P-C          MAARVCCQLDPVRDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR014006_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013984_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013975_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADHG
KR013961_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPAAHG
KR013876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSSAVPADHG
KR013875_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013866_HBx_P-C          MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013858_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013851_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013850_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013845_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPFPSSSAVPADHG
KR013822_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013817_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KR013814_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013813_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013810_HBx_P-C          MAARVCCQLDPARNVLCLRHVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013809_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013808_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013807_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013805_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013803_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013802_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013798_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013797_HBx_P-C          MAARVCCRLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013785_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013784_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013783_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013782_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013781_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013780_HBx_P-C          MAARVCCQLNPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013779_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013778_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLLSPSSSAVPADHG
KR013769_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013766_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013765_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KP148575_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP027477_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
KJ803780_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ803776_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KJ803770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPFGTLPSPSSSAVPADHG
KJ803762_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ790199_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ410510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
KJ410505_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAGHG
KJ410499_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410494_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410492_HBx_P-C          MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ173445_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173441_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173440_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ173439_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ173438_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173437_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173434_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ173433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ173426_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173394_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173393_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173391_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173314_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173307_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173304_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173296_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KF485389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
KF214677_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KF214667_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KF214655_HBx_P-C          MAARVYCQLDPPRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KF214652_HBx_P-C          MAARVYCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KC814925_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814923_HBx_P-C          MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814911_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814893_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814887_HBx_P-C          MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814854_HBx_P-C          KAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774356_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774346_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774342_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774337_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774298_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KC774295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPADHG
KC774293_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774287_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774285_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
KC774280_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
KC774277_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774272_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774267_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
KC774260_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
KC774259_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774257_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774252_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774247_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KC774239_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774238_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC774233_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774232_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KC774224_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774213_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774209_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774205_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774204_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774190_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774189_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPFGDLPSPSSSAVPADHG
KC774187_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPANHG
KC774182_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX661496_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661492_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX661489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX661488_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX560519_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
JX504546_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429913_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JX429907_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPFGTLPSPSSSAVPADHG
JQ801522_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801521_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801518_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801517_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSASAVPTDHG
JQ801503_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801497_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPTDHG
JQ801491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPIGTLPSPSASAVPPDHG
JQ801482_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSASAVPTDHG
JQ688404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ040163_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040141_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040131_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027332_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
JQ027320_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPFGTLPSPSSSAVPADHG
JN418561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418560_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
JN400089_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN400088_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN400087_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN315779_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN104434_HBx_P-C          MAAWVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHR
HM750140_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM750139_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM750138_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
HM011489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
HM011465_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GU721029_HBx_P-C          MAARVCCQLDPTRNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GU357845_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ872210_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
GQ475355_HBx_P-C          MAARVCCQLDPXRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
GQ475352_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475351_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475349_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475348_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475347_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475346_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ475345_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475344_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475342_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSFSAVPADHG
GQ475336_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475334_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ475330_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
GQ475329_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ475328_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475326_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475324_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475316_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475314_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475312_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
GQ475307_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475305_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ377620_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377616_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377609_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377608_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
GQ377605_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPABHG
GQ377600_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377599_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377591_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ377584_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377578_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377571_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377570_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377562_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
GQ377559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
GQ377554_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377551_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377545_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
GQ377541_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377531_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377530_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377524_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
GQ377523_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ259588_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227696_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227695_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227694_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227693_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ899795_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899783_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
FJ899776_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899775_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899772_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
FJ899764_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899763_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ787489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787486_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787474_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787467_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787466_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787465_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787464_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787457_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ787453_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
FJ787451_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
FJ787450_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ787443_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ787442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ751770_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562340_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
FJ562337_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562335_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAIHG
FJ562330_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562329_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562326_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ562320_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSLSAVPADHG
FJ562318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
FJ562301_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562297_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ562292_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562288_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562283_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562281_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562280_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
FJ562279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
FJ562264_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562258_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562251_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562244_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562243_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562233_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562232_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562225_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562221_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562218_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHG
FJ518810_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSTSAVPADHG
FJ386685_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386679_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ386673_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386667_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386664_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPSGTLPSPSPSAVPADHG
FJ386661_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
FJ386659_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386647_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386638_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSSSSSAVPANHG
FJ386632_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386630_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386629_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
FJ386626_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386621_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386619_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386613_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386609_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386607_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386602_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386591_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386588_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ386587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386579_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386577_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386575_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
FJ386574_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ151413_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
FJ032356_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032355_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032351_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
FJ032347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
FJ032345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939658_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939656_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939655_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939654_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939651_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939649_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
EU939645_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939644_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
EU939643_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
EU939641_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939618_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHG
EU939613_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939612_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939607_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHG
EU939601_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939593_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939572_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
EU939567_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939566_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939562_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939555_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939550_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939549_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939541_HBx_P-C          MAARVCCQLDPSRDVLCIRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
EU939538_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU939537_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU919165_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU919164_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916238_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916216_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU916215_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU881996_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU872008_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871978_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871977_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871975_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU796069_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
EU579442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU570074_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU570073_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU562218_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
EU560441_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU560440_HBx_P-C          MAARVCCQLDPPRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU554542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554541_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
EU522068_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439025_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439013_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439011_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306729_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306728_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306727_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU306726_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU306724_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306721_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306720_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306719_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF536065_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EF137803_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EF137802_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ993693_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993692_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993691_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993690_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993181_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
DQ890381_HBx_P-C          MAAGVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPATHG
DQ478899_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ478885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ377165_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377164_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377163_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377162_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089794_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
DQ089793_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSSSAVPADHG
DQ089757_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
D50520_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D50519_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D50518_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
D50517_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
D23681_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
D12980_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D00630_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641563_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY641562_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AY641558_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AY596108_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY311588_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY251142_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY247032_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY220702_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY220701_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
AY220700_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
AY206388_HBx_P-C          MAAGVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206379_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY206378_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY206376_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY167096_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY167090_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AP011098_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF533983_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461363_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461357_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF458665_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF384371_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF363961_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF355785_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB971715_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB971714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB900116_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB697510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB697490_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB675675_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AB675674_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AB670310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB670292_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
AB670291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670288_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670283_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB670281_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670272_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSTSAVPADHG
AB670260_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367422_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195946_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013843_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KJ173330_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173329_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774480_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774479_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774478_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774424_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHG
JF491448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
FJ032337_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
EU916241_HBx_P-RF-CB      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU916239_HBx_P-RF-CB      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU522070_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSVSAVPANHG
DQ478889_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478887_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AY817512_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSCSAVPAHHG
AB453985_HBx_P-RF-AC      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MK818227_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171648_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171634_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171600_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171597_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171582_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MK171521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171500_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANNG
MK171484_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSXPFGTLPSPSSSAVPADHG
MK171472_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171462_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171457_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171449_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171447_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
MK171444_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171430_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171394_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171358_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171330_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171318_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPANHG
MK171293_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171277_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171259_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171258_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MH488831_HBx_P-C          MAARTCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
KY881891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881816_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLPSSSSSAVPADYG
KY363283_HBx_P-C          MATRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSVAVPADHG
KY363268_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363252_HBx_P-C          MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KU964243_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964241_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KU964239_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KU964238_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964237_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KU964236_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964234_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KR014011_HBx_P-C          MAARACCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR013849_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013804_HBx_P-C          IAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013790_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013788_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KM875428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ598739_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598733_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598732_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598728_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598726_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KJ598725_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598724_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598722_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KJ598667_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ173324_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814910_HBx_P-C          MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814896_HBx_P-C          WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774355_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774353_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KC774352_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774326_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC774300_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAYG
KC774297_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774225_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
KC774221_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774179_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC163892_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163888_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163887_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163884_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661497_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX507212_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707774_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707772_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707771_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707770_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707769_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707768_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341902_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341885_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
JQ040164_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040156_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
JQ040151_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSXVPADHG
JQ040145_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040139_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040135_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
JQ040132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027321_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027319_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN418544_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418543_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
JN418538_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418533_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418523_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418514_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418512_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418511_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418507_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN418505_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
JN418503_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418501_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418497_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
JN418496_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418495_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
JN418494_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828931_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828930_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828929_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828928_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828926_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828924_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828923_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828922_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828912_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828911_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828910_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828907_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828906_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828905_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF436920_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ638218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
HM750135_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750134_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011502_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
HM011491_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
HM011488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSPSAVPADHG
HM011486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774493_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
GQ377607_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377602_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377594_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPXDHG
GQ377539_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562223_HBx_P-RF-CD      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGILSSPSSSAVPADHG
AB367800_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195955_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171633_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171619_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPSGTLPSPSSSAVPADHG
MK171615_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
MK171596_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171485_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171473_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171436_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSLSAVPADHG
MK171410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171399_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MK171398_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171397_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171393_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSSVPADHG
MK171368_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171362_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171359_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171340_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171328_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171327_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171301_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171282_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171269_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171265_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
MG826138_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVSADHG
MG826132_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826126_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSVSAVPADHG
MG826125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MF674494_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674457_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLPSPSSSAVPADHG
MF674398_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC318702_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279274_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY881872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY363261_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY363258_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
KX765852_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
KX765839_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KX429617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSSAVPADHG
KX276852_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESXGRPVSGPFGTLPSPSSSAVPADHG
KX276851_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276833_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESXGRPVSRPFGPLSSPSASAVPADHG
KU964228_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964227_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964224_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964222_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964219_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KT284759_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT284757_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KR819180_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
KR811754_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014002_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013996_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013974_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013969_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013905_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013902_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013899_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013883_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013882_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013869_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR013867_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013848_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013847_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013842_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013825_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013824_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013821_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013820_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESHGRPVSGPFGTLPSPSSSAVPADHG
KR013801_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013800_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAGHG
KR013799_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148572_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148563_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148551_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148466_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM875406_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM875405_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KM875404_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KJ803766_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHG
KJ803765_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598678_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSHSLSAVPAAHG
KJ598677_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSLSAVPAAHG
KJ598676_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598674_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPSGALPSPSLSAVPAAHG
KJ598673_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598672_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598671_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598670_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598668_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598666_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598665_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598664_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598663_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ410511_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ173323_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173288_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KF485390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KC875272_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875268_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875265_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875261_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814909_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814862_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774343_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KC774340_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774330_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPAAHG
KC774321_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSPSAVPADHG
KC774308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774304_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPANHG
KC774301_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774288_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774269_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KC774253_HBx_P-C          MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774251_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774250_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774243_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774240_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774226_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KC774219_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774208_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX504539_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504536_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504534_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX026877_HBx_P-C          MAARVYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801501_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ801495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ688403_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ341900_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341897_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JQ341878_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLXSPSXSAVPADHG
JQ341863_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
JQ341860_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040161_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
JQ040154_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB176642_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSXSAVPADHG
AB670276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ386639_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670254_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341896_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAVPADHG
KF873536_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
JQ341865_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
JQ341868_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276848_HBx_P-C          MAARLCCQLDPARBVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ341891_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341879_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341877_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027317_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPXSGPFGTLSSPSSSAVPADHG
HM011479_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KX276837_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
JQ040149_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLXSPSSSXVPADHG
KR013816_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013806_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP276255_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KP276254_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ410520_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173326_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173325_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KF917451_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774494_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774490_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774489_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774484_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774483_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774472_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
KC774471_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774470_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774468_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774466_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774463_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774454_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774452_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774449_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774443_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774442_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774435_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774434_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774428_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAAHG
KC774423_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774414_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESCGRPISGPSGTLPSPSSSAVPADHG
KC774328_HBx_P-RF-CB      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774324_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774322_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774317_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774307_HBx_P-RF-CB      MAAWVCCQLDPARDVLCLRPVSAESRGRPVSRPFGSLPSPSPSAVPADHG
KC774305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KC774291_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774258_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774234_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KC774230_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774193_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774186_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774183_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX661487_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPADHG
JX661486_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX661485_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX429898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX026887_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JQ040142_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN400086_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF491456_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491451_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491449_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HQ700547_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSSSAVPADHG
HQ700526_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSLSAVPADHG
GQ377633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377627_HBx_P-RF-CD      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377614_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377611_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ377604_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377590_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377565_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377564_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377556_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377549_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377548_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHG
FJ787480_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787446_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562294_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562277_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386649_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ386643_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
FJ386633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386586_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
FJ386585_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ386578_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
EU939632_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
EU939606_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSSSSSAVPADHG
EU939602_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
EU939581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939551_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
EU919167_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
EU919166_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
EU916240_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU916232_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU916228_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU881995_HBx_P-RF-CB      MAARVSCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU787444_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU717211_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPATHG
DQ478898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
DQ478892_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AY862864_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY247030_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY167095_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF330110_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670303_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
AB367419_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367400_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB270535_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPATHG
AB205152_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB198084_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014375_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
X52939_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSVVPADHG
MK171640_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171635_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHG
MK171631_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171629_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171625_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171621_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171620_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171614_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MK171611_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171609_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
MK171591_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171590_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHHG
MK171581_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171578_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171574_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
MK171557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171551_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171550_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171541_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171530_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171529_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171527_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171514_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171512_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171509_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171508_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPABHG
MK171487_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171483_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171479_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171477_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSSSSSAVPADHG
MK171458_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171456_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171450_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171438_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171434_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171432_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MK171429_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSTSSSAVPADHG
MK171415_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
MK171411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171402_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171391_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171390_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171387_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MK171378_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171375_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171373_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171367_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
MK171357_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171346_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171314_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
MK171312_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHG
MK171311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171298_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
MK171281_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
MK171275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MK171271_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171264_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171262_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171260_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MH887433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MH818373_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MH488838_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488810_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPANHG
MH488809_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPANHG
MH094411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG893557_HBx_P-C          MAARVCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826123_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
MG776414_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG776413_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF059674_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
LC279262_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279261_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279260_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279259_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279258_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
LC279257_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279256_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279254_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279252_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279251_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
LC279250_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279245_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
LC090200_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY882003_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY882002_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY882001_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881997_HBx_P-C          MAARVCCQLDPARYVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881994_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881991_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881990_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881989_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881988_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881984_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881981_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881980_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881974_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881972_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KY881971_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881966_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881962_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881960_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881888_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881887_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881886_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881884_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881881_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881879_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KY881875_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881871_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881870_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881819_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KY881818_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881809_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881802_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY470905_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470904_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470903_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470902_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470901_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470900_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470899_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470897_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470896_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470895_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470881_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363287_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KY363286_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KY363285_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KY363266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363264_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAIHG
KY363253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX276831_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964365_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964364_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964363_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964362_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964358_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964357_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964356_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964355_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964353_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964352_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964350_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964349_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964348_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964346_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964344_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964343_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964342_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964340_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964337_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964336_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964334_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964213_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964212_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964211_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964210_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964209_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964208_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964207_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964206_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964205_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964204_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964203_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964202_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964201_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964200_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964183_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964182_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964181_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964180_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964178_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964177_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964175_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964174_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964173_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHE
KU964172_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964171_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964170_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964169_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964078_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964077_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964075_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964074_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964073_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964071_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964070_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964069_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964068_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964067_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964066_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
MK171344_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171446_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171439_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX276835_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPANHG
KU964065_HBx_P-C          MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964076_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KJ598647_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598648_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598649_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598650_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598651_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598652_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598653_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598656_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598658_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
MK512469_HBx_P-A          MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHG
AY161142_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161143_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161144_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
EF594769_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
KX357650_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922414_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922415_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922416_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922420_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922421_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922417_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922418_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922419_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
AY161147_HBx_P-RF-DA      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVQYDHG
AY161140_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AY161141_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AB241115_HBx_P-A          MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHG
KM519452_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KM519453_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
MK512475_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KU736918_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736919_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB453988_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB246336_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHG
AB937791_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
AB937796_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
FJ692564_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692565_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692586_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692588_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692590_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692591_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922424_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KX276769_HBx_P-A          MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB116086_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHG
FM199977_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
AY233278_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHG
MF115873_HBx_P-C          MAGGLCCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MF115871_HBx_P-C          MAARLCCQLDPARDVPCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MH464811_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
FJ692570_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYG
FJ692563_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
DQ020002_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KX357649_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHG
AY233290_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHG
MF925400_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHG
AB219430_HBx_P-B          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KX648549_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
GU563547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FJ692592_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
KJ854691_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ854701_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KP168432_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHG
KJ854688_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KJ854689_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854692_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
KJ854696_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854703_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692577_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692572_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHG
FJ692571_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692567_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692562_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNG
MK512476_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512465_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHG
MK512462_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512458_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHG
FM199976_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
AF043560_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692557_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692574_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692576_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692578_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692583_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692584_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692585_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
AB116091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHG
AB116093_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AB116094_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692558_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692559_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692561_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FM199975_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KF214661_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594768_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
EF594767_HBx_P-C          MSARLYCQLDSSRDVLCLRPVGAESRGRPLPRPLGTVSSPSPSAVPSDHG
KT151611_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHG
AB116084_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116083_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
AB453986_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214660_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHG
JN574721_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KM243029_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
AY161138_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161139_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KT151614_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHG
FJ876191_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876246_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594763_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905429_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905425_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KT366466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KF214666_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF214665_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315785_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116087_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116085_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB241114_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
AB246335_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AF090842_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151613_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHG
FJ876251_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876238_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876229_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876192_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594766_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAISSPSPSAVPSDHG
AB116092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHG
AY373429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373432_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214659_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
FJ876252_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876230_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876206_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876205_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876204_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876203_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876202_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876190_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594764_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
EF594758_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925372_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHG
M57663_HBx_P-A            IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KT235618_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876239_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594760_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925361_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366470_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366469_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366468_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366467_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151618_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KT151615_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151616_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
MK512464_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHG
MK512456_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
JN182321_HBx_P-A          TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KP168435_HBx_P-A          MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHG
AY934772_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHG
AB453989_HBx_P-A          MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB116089_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151612_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151617_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
EF103278_HBx_P-A          MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLG
KU605535_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF214656_HBx_P-RF-AC      MAARMYCQLDSSRDVLCIRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
GQ161753_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
MK512461_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KX357647_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHG
KU605534_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605533_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KP168425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168422_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
KJ854699_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854687_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF922406_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922408_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922409_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF214662_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
KF214658_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214657_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214663_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875259_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875256_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875253_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875252_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875251_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
HM535200_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHG
DQ315786_HBx_P-A          MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
AY934771_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233281_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233279_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB246317_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB194950_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AY233288_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692573_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AB116090_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB937795_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KC875254_HBx_P-A          MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875258_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116082_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
DQ315784_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875255_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875257_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHG
MF925373_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
MF925385_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT347091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357644_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MK512468_HBx_P-A          MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHG
MK512466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MF925368_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KU605536_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168434_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHG
KP168429_HBx_P-A          MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168424_HBx_P-A          MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JX154582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
FN545836_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AY934769_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHG
AY233275_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AF297625_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHG
KF922433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854685_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854686_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
MF772353_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854695_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
AB453987_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
EU366129_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
FJ692575_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KM606748_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464817_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KX357643_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT347092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHG
KP168430_HBx_P-A          MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
AY934765_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934766_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934770_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934773_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
DQ020003_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
KU736920_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
JX154581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JN182318_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KJ854707_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHG
JN182333_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182332_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182331_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182330_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182328_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182325_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182324_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182322_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182323_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
MF772351_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
AB076678_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AM494718_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233274_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233276_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233282_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233283_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233284_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233287_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233289_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934767_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
AY934768_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934774_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
FJ692566_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHG
AB076679_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023660_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023661_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023662_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023663_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
MK512472_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AY233285_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY903452_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF922434_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922435_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922436_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922437_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010776_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010777_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010778_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854690_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHG
KJ854694_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854697_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854700_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHG
KJ854702_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854704_HBx_P-A          MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854705_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854706_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168423_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHG
FM199974_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHG
FM199979_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199980_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199981_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563545_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512457_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512459_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512463_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512473_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512474_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512477_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHG
MK512471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHG
MK512470_HBx_P-A          MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHG
MH464810_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464809_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHG
MH464808_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHG
MH464812_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHG
AY233277_HBx_P-RF-AC      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU605539_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605538_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605537_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KT347088_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KX648547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KJ586810_HBx_P-RF-AF      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464830_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464828_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464825_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464818_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464815_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464814_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464813_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
LC051141_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
KX648548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357646_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357645_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357642_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT347087_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHG
HM011485_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHG
KJ843183_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KP718085_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHG
KP718086_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KC814919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESCGRPISGPFGTLPSPFSSAVPPDHG
JF754625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGTESRGRSFSGSLGTFSSPSPSAVPTDHG
MG776525_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MK693108_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSFPSPSAVSTDHG
EF103279_HBx_P-D          MAGRLCCQRDLARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674412_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
MG776761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGTPGTLSSPSPSAVSTDHG
JN688678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDYG
GQ922001_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922002_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
X85254_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTFSSPSPSAVPTDHG
MG776524_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AB112066_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN792903_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792904_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792905_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792906_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792907_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792909_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792910_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792912_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN688689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVPTDHG
MG776777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776576_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KC875315_HBx_P-D          MAARLCCQLDPARDVLCLRPGGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JQ032006_HBx_P-D          MAARLCCHGVPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ922000_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464169_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN066387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ377592_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPSVVPTDHG
AP011108_HBx_P-RF-CB      MAARLCCQLDTSRDVLCLRPVGAESRGRPVSGPFVPLPSSSSSAVPADHG
HM363593_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPTDHG
MG776751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776473_HBx_P-D          MVVRLCCQQDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
KX827292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KF471660_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KC875279_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
JN792911_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN642128_HBx_P-D          MAARLCCQLDPARDVLCLRPVGDESRGRPFSGPLGTLSSPSPSAVSPNHG
JN040811_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040795_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
DQ464175_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPRNHG
AB270542_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSSDHG
AB231909_HBx_P-B          MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
DQ464165_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464166_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464167_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464164_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
GU456671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
FJ904440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
MG776797_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH724215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MH724220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MG776747_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776748_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776742_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776604_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776585_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776779_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776567_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776569_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776597_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MF925366_HBx_P-D          MAARLCRRLEAARDVLCLRPVGAESRGRPLPGPLGALPSPSPSAVPTDHG
KM524356_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
KF471647_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSTDHG
KF471642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642133_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
MG776639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN257209_HBx_P-D          MAARMCCQLDTARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
JF754615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSSSPSAVSTDHG
GQ205384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
DQ315779_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
FJ904410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
HQ700458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
FJ904395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KJ470889_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
AY796032_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY236160_HBx_P-D          MAARPCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AJ344116_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGTISSPSPSAVSTDHG
AB674429_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT364721_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KC774236_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
JQ801490_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
JQ801515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ410515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
JN574724_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ598727_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
KJ598736_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KJ598737_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KU964235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
FJ023645_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPISGPFGTLPSPSASAVPTDHG
EF594753_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AY721609_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
KP090179_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTAHG
KJ586811_HBx_P-RF-DF      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC774450_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFQGPLGTLSSPSPSAVPTDHG
FN594769_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGDESCGRPFSGPLGDLPSPSLPAVPTDHG
FJ904442_HBx_P-RF-DE      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904428_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPIGAESCGRPVSGPLGDLSSSSLPAVPADHG
KM606739_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
S77748_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN066395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK693107_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776731_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776539_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776535_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776416_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776397_HBx_P-D          MAARLCCQLGPARDVLCLRPVSAESRGRPFSGPLGTLPSPAASAVPPNHG
MF618341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KX827300_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
KT749845_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT366508_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPSPSAVSTDHG
KM519455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KJ647355_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875314_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875286_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ707687_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGALSSPSPSAVSSDHG
JF754632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
JF754630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754604_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTFSSSSPSAVSTDHG
JF754593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
HQ700454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ236016_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAIPTDHG
HM750153_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456668_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPTPSAVSSDHG
GU456637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLASPSPSAVSTDHG
GQ477455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
FJ876257_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ692533_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRTLSSSSLPAVPTDHG
FJ562338_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGSLGTLSSPSPSAVPTDHG
EU594434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF594771_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
DQ464168_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ336682_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
AY721605_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY090452_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AJ627224_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AJ627223_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGSLGTLSSPPPSAVSTDHG
AB674425_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB188244_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU051424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051426_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
HQ700516_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDLSSPSSSAVPTDHG
DQ089778_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB205125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
DQ089803_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ315781_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ315782_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ315783_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
EF594749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EF594754_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EU717214_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU872005_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939609_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
FJ023652_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSASAVPTDHG
GQ924612_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
JN827423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MF488702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN688717_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ205386_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
FJ349221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN066403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH464838_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464836_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776749_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPYPSAVSTDHG
MG776668_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVPTDHG
MG776582_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSACAVPPNHG
MG776543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KX423711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN642135_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642132_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040819_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
JN040810_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040808_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTISSPSPSAVSTDHG
JN040767_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
JN040762_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGPFSSPSPSAVSTDHG
JN040751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754619_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754614_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JF754592_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
HQ700481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HM750156_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTATVSTDHG
GU456678_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSTPSPSAVSTDHG
GU456672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
GU456670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
GU456669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSASPSAISTDHG
GU456642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSTVSTDHG
GU456636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
GQ183463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
FJ904445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ349206_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPPAVSSDHG
AJ627215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSVHG
MF674418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KY670782_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGGLPSPSLSAVPTDHG
JN040786_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JN040787_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754607_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN688679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN664915_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPFSGSLGSLSSSHPSAVPTDHG
AY800249_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATLG
AB194949_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPFGTLSSPSPSAVPTDHG
MG776745_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776734_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776427_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594759_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSXSPSAVPPDHG
FN594751_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTNHG
DQ060823_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
MN507836_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724225_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724219_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MH724218_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MG776759_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776623_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MG776544_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
KX357638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
KU668436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090178_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090177_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM577668_HBx_P-D          MAARLCCQLDTARDVLCLRPVSAESRGRPVSGPLGTLASPSPSAVSTDHG
KF471658_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF170739_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257167_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGSLSSPXTSAVSTDHG
JN040752_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754588_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700514_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
FJ904427_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPTDHG
DQ464178_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSTSPSAVPTDHG
DQ464174_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB674409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270548_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSLSAVSTDHG
AB270537_HBx_P-D          MAARLCCQLDPAWDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB104712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG571335_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF925403_HBx_P-C          MAARLFCQLDSARDVLCLRPVGAESCGRPLSGPIGDLPSSSSSAVPTVHG
MF674442_HBx_P-C          MAARLCCQLDPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU051423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPTDHG
KT987426_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KF214668_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLQGPLGTLPSPSPSAVPTDHG
KC774218_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
JQ801493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPTASAVPTDHG
GQ358154_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAIPTDHG
DQ089804_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSASAVPTDHG
AF068756_HBx_P-C          MAARLCCQLDPARDVLCLRPFGAESRGRPISGPFGALPSPSSSAVPTDHG
MF925362_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHG
GQ161775_HBx_P-E          MAARLXCQLDXSRDVLCLRPVGAESRGRPLSGXLGTLSSPSPSAVPTDHG
GQ161806_HBx_P-RF-EA      MAARLXCQLDXSRDVLCLRPVSAESXGRPLSGSLGDLSSPSPSAVPTDHG
KM577667_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM577666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPTDHG
KM577665_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577664_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577663_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM524359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KM524337_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
KM524336_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN664933_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
GU563560_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ183486_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103285_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
DQ315777_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
AY233295_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
MH464844_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MF772354_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
JN688722_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVSTDHG
JF754631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
MH464834_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU155893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU414143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366505_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM606751_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM606741_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM359442_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
KJ470898_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470891_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
KF170740_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPPGDLSSPSLPAVPTDHG
JN664934_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664925_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GU177079_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
FN594771_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLSAVPTDHG
FJ904441_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904416_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904409_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
FJ904400_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ692536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AM494716_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTNHG
AB270538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLASPSPSAVPPDHG
AB188245_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLSAVPTDHG
AB048703_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB048702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
JQ272902_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349239_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
AB274982_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
Y07587_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESHGRPFSGSLGALSSPSPSTVSTDHG
V01460_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
S41175_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSTVSTDHG
MN507839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN507837_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MN182682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066385_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK618433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSTVSTDHG
MK618427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MK598674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
MK598669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPFGTLSSPSPSAVSTDHG
MK598658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
MK598644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MK598640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK507914_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK507912_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MK507911_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
MK507910_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK052975_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052973_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052971_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052959_HBx_P-D          MAARLCCQLDPARDVPCLRPVSAESGGRPVSGPPGTLSSPSPSAVPPDHG
MK052949_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MH724251_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MH724250_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724249_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724248_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724247_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724238_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPFPSAVSTDHG
MH724233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MH724230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724227_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724226_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724224_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724221_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776783_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MG776756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776732_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MG776718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRTLGTLSSPSPSAVSTDHG
MG776701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776624_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRRRPFSGPLGSLSSPSPSAVSTDHG
MG776616_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSVVSTRHG
MG776599_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776598_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776596_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776592_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776591_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776589_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776588_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776583_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776579_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776571_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776568_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776561_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776560_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776559_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776558_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776554_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776546_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MG776522_HBx_P-D          MAARLCCQLDPARDVXCLRPVGAESRGRPFSGPLGTFSSPSPSXVSTDHG
MG776509_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776495_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776464_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776448_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVSTDHG
MG776415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776394_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776393_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MF925363_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MF618342_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
MF618339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF488704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
LT992454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPPDHG
LC365689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KX423713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KX357639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTHSSPSPSAVSTDHG
KX196234_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196222_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196221_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196212_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196209_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736925_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736924_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU668448_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668447_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT366507_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT366502_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSHSTSALSTDHG
KT366498_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366497_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT347090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT235632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT235630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT235624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
KT235615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSTDHG
KP317981_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP090181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KP090180_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM606745_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGSLGTLSSPSPSAVPTDHG
KM524345_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM524340_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF922432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSSSLPAVPTDHG
KF679993_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679992_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679990_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSFGTLTSPSPSAVPTDHG
KF679989_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF471646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471645_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSTSAVSTDHG
KF061169_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061168_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061167_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KC875337_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875336_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875335_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875334_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875326_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875321_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875319_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875317_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
KC875313_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875306_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875304_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875302_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875285_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875282_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFQGPAGTLSSPSPSAVPTDHG
KC774444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPPAVSTDHG
KC774437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JX096957_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX096954_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JQ707706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707703_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707702_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707700_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707699_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707698_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707697_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707694_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707693_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707691_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN688695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN664938_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664937_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664930_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664928_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664922_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664921_HBx_P-D          MAARLCCQLDPARDILCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664920_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664917_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664914_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664911_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664910_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
JN664909_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN642163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN642155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642146_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTNHG
JN642138_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPLGTLTSPSPSAVSTDHG
JN642131_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642130_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642126_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN574725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JN257205_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257185_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257182_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
JN257181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN040794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTISSSSPSAVSTDHG
JN040790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JN040788_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040776_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040766_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
JN040753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSHSAVSTDHG
JF911690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
JF911683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JF754612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754602_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSTDHG
HQ833471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSPISTDHG
HQ700513_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700512_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSTSAVSTDHG
HQ700480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPLGTLSSPSTSAVSTDHG
HQ700470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HM750151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPTDHG
GU456679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSPSAVSTDHG
GU456676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVSTDHG
GU456662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDYG
GU456655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ477457_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ205389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205388_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
GQ205380_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ183484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
GQ183478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ183470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
FJ904443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904433_HBx_C-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGGLSSPSLPAVPTDHG
FJ904432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVSTDHG
FJ904429_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904399_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
FJ876254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ876242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ692532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
FJ349232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349213_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSTGTLSSPSPSAVPTDHG
FJ349209_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU939680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU787446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU594397_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414140_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTNHG
EF594774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ486022_HBx_P-D          MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ486021_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464173_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464172_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464170_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ336690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336684_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336683_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336680_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ315778_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
DQ315776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY741797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
AY741796_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741795_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY721612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721610_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721607_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY373431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY236164_HBx_P-D          MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY233296_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY233291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
AY161160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161157_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161156_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161153_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161152_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY090453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AM422939_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AJ627219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AJ627218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AJ627216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AF280817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB674422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLRSLSSPSPSAVSTDHG
AB674407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB246347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
AB222711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
AB126581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB109479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB104709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB048701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
MF674484_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765843_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLSSPSSSAVPTDHG
KX765840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765838_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGALPSPSASAVPPNHG
KX765837_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSASAVPPVHG
MN066399_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
AB330368_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KJ803753_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSSSSSAVPTDHG
JN642137_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257216_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257210_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257191_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257174_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JF754613_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
EU594406_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY040627_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPTAHG
MG776729_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSPSAVSTDHG
MN066388_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MK355501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MH724241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724223_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776789_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776763_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776760_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776720_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776717_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776671_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776670_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MG776655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MG776652_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776587_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776586_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776566_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776555_HBx_P-D          MAARLCCQLDPARDVVCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776553_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776528_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776506_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776498_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVPTDHG
MG776470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776449_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776417_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776400_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776399_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776391_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTNHG
M32138_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX260231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KP317983_HBx_P-D          MAARLCCQLNPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KM524348_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KJ470896_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KF471654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642166_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642156_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
JN642149_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642147_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSTDHG
JN642145_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642142_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257202_HBx_P-D          MAARLCCQLDPARDVLCXRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257201_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257200_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN257183_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257170_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257149_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPLGTLSSPSPSAVSTDHG
JN257148_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040829_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040824_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040773_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040760_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPSAVSTDHG
JN040755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754634_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSXSAVSTDHG
JF754627_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF754626_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754617_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754609_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754598_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754591_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
HQ833467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700489_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
GU456683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456675_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456673_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
GU456665_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSSSPSAVSTDHG
GU456638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
FJ349233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349217_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
EU787439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787438_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EF103276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464182_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF151735_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121239_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AF043594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AF043593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AB674416_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674414_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB674411_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270550_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLSSPSPSAVSTDHG
AB270549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB222710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGTLSSPSPSAVSTDHG
AB210820_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
AB188242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MH220971_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPTDHG
MG826122_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MG725248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925394_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPTDHG
MF925365_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF674504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674467_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674444_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
MF674390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674388_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765842_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765822_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ027310_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPXGTLPSPSSSAVPTDHG
FJ904398_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLSAVPTDHG
FN594760_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594753_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
MK052954_HBx_P-D          VAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MG776610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776574_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904446_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KJ803785_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801477_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN642139_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642127_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257207_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257206_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257204_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257164_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257154_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVSTDHG
JF754616_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGPLSSPSPSAVSTDHG
AB674433_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB033558_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHG
Z35716_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
X80926_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
X80924_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
MN507853_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK693109_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598673_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
MK598672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598668_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MK598649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
MK598642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGLPFSGPLGDLSSPSPSAVSTDHG
MK598636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK507913_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK355500_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK052961_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052952_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MH724231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724217_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776788_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776762_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776752_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776743_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776739_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776738_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
MG776735_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776730_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776727_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776723_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTIHG
MG776683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776681_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSTDHG
MG776548_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776547_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776536_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776518_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776507_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776492_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776486_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSASAVSTDHG
MG776482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776436_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
MG776423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF618343_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KY629630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLSAVSTDHG
KY382414_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY382412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX827301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KX827291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX827290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSTVSTDHG
KX423692_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736927_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KP322601_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP317982_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KM577670_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPSAVSTDHG
KM524342_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KJ647352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSSSPSAVSTDHG
KF584166_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584165_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584164_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584162_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584161_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
KF061170_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KC774462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTLSSPSPSAVPTDHG
JX096958_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096956_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096955_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
JN642164_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642161_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
JN642159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
JN642136_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
JN642129_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257199_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257196_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257190_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLTSPSPSAVSTDHG
JN257171_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257169_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040830_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JN040826_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSTVHG
JN040793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040780_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040769_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040759_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN040758_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF911682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSTDHG
JF754635_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JF754618_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754605_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JF754601_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833465_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700553_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700488_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLSSPSTSAVSTDHG
HQ700478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700464_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700451_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700450_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700449_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700448_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700447_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HM750155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
GU456664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456661_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456660_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ477459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
GQ477456_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ899792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349234_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU939681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787447_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
EU787445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
EU787436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594425_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594416_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594411_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594400_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594399_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594398_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594396_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
EU414138_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414136_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ111986_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY945307_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY661793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AY661792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121240_HBx_C-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB583680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB330370_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB330369_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB246348_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
AB222712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB222709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205127_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF925410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925408_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925406_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925377_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGALPSPSSSAVPTDHG
MF925375_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674474_HBx_P-C          MAARLCCQLDPARDVVCLRPVSAESSGRPISGPFGPLPSPSSSAVPTDHG
MF674412_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MF674402_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF488703_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765851_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAKSRGRPLSRPFGTLPSPSSSTVPTDHG
KX765850_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765848_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765834_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGTLPSPSSSAVPTDHG
KX765833_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765832_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KX765831_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSASAVPTDHG
KX765825_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
KX765821_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KX765818_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX276847_HBx_P-C          MAARLCCQLDPARDXLCLRPVGAESRGRPXSGPFGXLPSPSSSAVPTDHG
KX276850_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESSGRPXSGPFGALPSPSSSAVPTDHG
HQ700468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AB900115_HBx_P-C          MAARLCCQLDPARDVLCLRPVGDESRGRPVAGPFGPLSSPSSAAVPADHG
HQ700574_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
KR013923_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013942_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
KC774477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSSDPG
MK052960_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPPPSAVPPDHG
AF411410_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPPDHG
JF440003_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440002_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440017_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MG826150_HBx_P-RF-BC      MAARVGCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSPAVPADHG
KX423707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423722_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
FJ562267_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
GU456651_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTISSSSPSAVSTDHG
KJ803792_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ598693_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KC774249_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KC774347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598694_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598698_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598702_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598703_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598689_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSTTAVPADHG
FR714496_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCRRPLSGPLGDLSSSSASAVPPVHG
FJ349212_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AJ344117_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
MH724244_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAVSTDHG
JN664947_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGPRSSSHPSAVPTDHG
JN040821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
GU456650_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPASSAVSTDHG
GU456644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVSTDHG
GU456640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040814_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSTSAVSTDHG
AB674419_HBx_P-D          MAARLCCQLDPARDVLCLRPVEAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KU963887_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRHVSGPFGTLPSPSSSAVPADHG
KU963886_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963888_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963893_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPANHG
KU963894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963895_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963896_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963897_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963898_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963899_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KR013829_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAAPADHG
KR013776_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173293_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173294_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173315_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAIPADHG
KC774268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAIPADHG
KC774276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAIPADHG
JX429912_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSSSSSAIPADHG
JX429904_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026884_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
GU434374_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
GQ377521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPADHG
JX429896_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
EU871982_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU939604_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
MH488818_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAVHG
MG776419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776516_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776523_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
EU185780_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JF440011_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN040803_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF440015_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCRRPFSGSLGTLSSPSPSAVPTDHG
JF440006_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AB106564_HBx_C-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
MN507842_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
JQ518361_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
FJ349215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
KC814913_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC814880_HBx_P-C          FAARVCCQLDDAEDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814877_HBx_P-C          MAARVCCQLTEAGDVLCLRPVGAESRGRPVSGPVGTLPSPSSSAVPADHG
AB117758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
MG776451_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776457_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776502_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KJ173443_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173444_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893553_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC012653_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AY206374_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGDLPSPSPSAVPADHG
MG776776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPPAVSTDHG
MG776440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSADHG
MG776428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPCTVSTDNG
KF471655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JQ927384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPXTPAVSSDHG
MK171510_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSTSAVPADHG
MK171345_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPANHG
KR013763_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC814916_HBx_P-C          MAARVCCQLGPAEYVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939596_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ331046_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB674427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754603_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040813_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
GQ855544_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLPSPSSSAVPTDHG
DQ486025_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVPTDHG
FJ349211_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
HQ700510_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
JN040754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040815_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040816_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN664936_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664948_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KC875318_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVPTDHG
KC875320_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875322_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875323_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875324_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875329_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875330_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875331_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875332_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875333_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196217_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196224_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196225_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196235_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724242_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB300365_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB471848_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471850_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF458664_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
AY206384_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
DQ980547_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916217_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
FJ562275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787447_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ787448_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ377546_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429906_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774248_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173281_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173282_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173301_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173427_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173428_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173435_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173436_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013771_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013773_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013830_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013831_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013832_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013833_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013834_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013909_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KU963937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
MK598653_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MK598652_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MG826148_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KY881840_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSPSSLPVVPADHG
KY363263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHG
KY363262_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHG
KJ647349_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KF471643_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVSTDHG
JX898688_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ904397_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSSSXPAVPADHG
AB583679_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVTSPSPSAVSTDHG
AB274980_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X02496_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MN066382_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
MH464854_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
KP168419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPSTPPVSPDHG
JN688708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGXLGTXSSPSPSAVPTDHG
JN664913_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
FJ904418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MK171488_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPANHG
KU963919_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963918_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963917_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963916_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963915_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KR013774_HBx_P-C          MAAGACCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013772_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ598752_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598751_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598749_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598743_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598740_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KC163874_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899769_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH724243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724222_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH481859_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MG826144_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADYG
KX765835_HBx_P-RF-GC      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX660685_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX357629_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGTLGTLSSPSLPAVPPDHG
KU695744_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPFGDVPSPSLSAVPADHG
KC774426_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774420_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
JF440014_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440013_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSSSAVPTDHG
JF440012_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440010_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440009_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440008_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440007_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440005_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440004_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440001_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440000_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439999_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439998_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439996_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439995_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439994_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MG776691_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
MG776613_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN642158_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
MK171423_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814914_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814892_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK618444_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK618440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK618439_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH481861_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481860_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481858_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH464852_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH464846_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH094410_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG893561_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
MG826141_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF925381_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
LC279267_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279266_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279265_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279264_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
KY363273_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KX774505_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPADHG
KX660675_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPITGPSGSLPSPSSSAVPADHG
KX357636_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSLPAVPPDHG
KX357631_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDDG
KU695742_HBx_P-RF-CB      MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGALPSPSSSAVPADHG
KM213033_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN664935_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
HM750146_HBx_P-RF-DC      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
FJ904425_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLSSPSLPVVPTDHG
FJ349207_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPPAVPTDHG
AB300369_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
X65258_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
MK171626_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171593_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171543_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171533_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171522_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
MK171363_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171355_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488859_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MF059725_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276853_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814924_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814865_HBx_P-C          LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814858_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814857_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341889_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
MG826147_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MF593359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU963938_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963936_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU679954_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
JX898696_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898695_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898693_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898690_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898686_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349241_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
FJ023659_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPAVHG
AJ627221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AF411409_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB210819_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK618443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK618441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVSTDHG
JX898698_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
JX898699_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
MG776726_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK171333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM875423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
KJ997866_HBx_P-C          MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ410521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
KJ173295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX026885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
X65259_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
MK541689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSRSSSHPSAVPTDHG
MH685719_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGSLGTLSSPSLPAVPTDHG
KY470855_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470854_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470853_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGSLSSPSSSAVPADHG
KY470850_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470849_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470847_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470846_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470844_HBx_P-RF-DC      IAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KY470843_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KX827299_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSLPAVPTDHG
KX357627_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KU736922_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHG
KU736921_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHG
KU711666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVSTDHG
JN257162_HBx_P-D          MAARLCCQLDPXRNVLCLRPVGAESRGRPFSGPLGTLSSPSPXAVSTNHG
X68292_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
U95551_HBx_P-RF-DE        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN507850_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN507835_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK720628_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK720627_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK618445_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
MK618442_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
MK618438_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK598656_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK598654_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK516280_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
MK516279_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
MK321265_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK052967_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MH724239_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464851_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464835_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPISRSLGTLSSPSPSAVPTDHG
MG893555_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MG893554_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MG826151_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSSSSSAIPADHG
MG826146_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPIGGLPSPSVSAVPADHG
MF967563_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618346_HBx_P-RF-DE      MAARMCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
MF488705_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF488699_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
M38454_HBx_P-RF-CB        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
LC458432_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY629632_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPAAHG
KY470893_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY363272_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KX827302_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX660682_HBx_P-RF-DC      MAAXVCCQLDPARDVLCLRPVGAESRGRPXSGPFGSLPSPSSSAVPADHG
KX660680_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KX660677_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KX660674_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KX096713_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KU964351_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964317_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964316_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964315_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964314_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964313_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964312_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964311_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964310_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964309_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964308_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964307_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964306_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964304_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964303_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964010_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964009_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964008_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964007_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964006_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964005_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU963883_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963870_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963869_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963868_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963867_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963866_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963865_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963864_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963863_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963862_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963861_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963860_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963859_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963858_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963857_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963856_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU695746_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGDLPSPSASAVPADHG
KU679958_HBx_P-RF-CB      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGDVPSPSSSTVPADHG
MH724252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JQ341886_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JQ341870_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
X80925_HBx_P-RF-DE        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHG
MK052968_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052957_HBx_P-RF-DE      MAARLCCQLGPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MH481862_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MF925404_HBx_P-RF-AC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925397_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925396_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925388_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925386_HBx_P-RF-AC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPASSAVPADHG
MF925371_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
KY470858_HBx_P-RF-GC      MAVRLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KU963944_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963943_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963942_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963941_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963940_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963939_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963935_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963934_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963933_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963932_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963931_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963930_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
JN257203_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK052969_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MG893559_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
KX357641_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVCAESCGRPFSGPIGDLPSPSPPAVPTDHG
KX357635_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357634_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357633_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357632_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVDAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357630_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357628_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357626_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDYG
KX357625_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KX357624_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357623_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KU736923_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KU736917_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSPSLPAVPTDHG
KU736916_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPSLPAVPADHG
KU736915_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHG
KU736914_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHG
KU695745_HBx_P-RF-CB      MAARLCCQLDPSXDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
X75656_HBx_P-RF-CB        MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
MK052976_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGSLSSPSPSAVPPDHG
MK052970_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MH746813_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH746812_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH746811_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH724240_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSVVPTDHG
MG826149_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826145_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MG826142_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MF925401_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
MF925389_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
LC416040_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY670781_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPANHG
KY471007_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471006_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471005_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471004_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471003_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471002_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471001_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHG
KY471000_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470999_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470998_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHG
KY470997_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470996_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KU695743_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHG
KU695741_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHG
KY470871_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KX354997_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KY470865_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGGLPSSSSSAVPTVHG
MH368022_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KX660689_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSSAVPADHG
KX660686_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
KX660684_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964380_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964379_HBx_P-RF-DC      MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964374_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964372_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964370_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964367_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU679956_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAXPADBG
KU964366_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU963920_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963921_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963922_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963923_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963924_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963925_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963926_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963927_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963928_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963929_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KY470977_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPTDHG
KY470968_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470967_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPPPSSAAVPTDHG
KY470965_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470969_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470970_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470971_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470972_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470973_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470974_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470975_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470976_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470978_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470966_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KU679945_HBx_P-RF-CB      MAARLCCELDPTRDVLRLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873537_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873543_HBx_P-RF-CB      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873538_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873539_HBx_P-C          MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873541_HBx_P-C          MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGXLPSPSSSAVPADHG
KF873540_HBx_P-RF-CB      MAARLCCXLDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873542_HBx_P-RF-CB      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
JN664924_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
AF143298_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HQ700495_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700496_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700498_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
HQ700499_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
AY161146_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAIPSDHG
MG776628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KR013839_HBx_P-C          MAVRLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KC163906_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
EU306672_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
AB493844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AB493842_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AY161145_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPADHG
MK171535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSASAVPADHG
KR014021_HBx_P-C          MTARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
MG776379_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776491_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
AB112348_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
KY470980_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470981_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470982_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470984_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470988_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KR013836_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013837_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013838_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013840_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013841_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013835_HBx_P-C          TAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KJ586803_HBx_P-RF-AF      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ032007_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KC774459_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JN257193_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN257194_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KY363280_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KJ803818_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803799_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPFGTLPSPSSSAVPTDHG
HQ700556_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSFAVPANHG
GQ924609_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803794_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ349225_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
FJ023642_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDYG
AB112408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
AB074756_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
AB247916_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
AB031262_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSPSAVPTDHG
AP011097_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPTDHG
KC875260_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHG
AF297621_HBx_P-A          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP148472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997829_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997830_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997831_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB105173_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF223957_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EF594748_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSPSAVPTDHG
FJ023639_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
FJ023649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023657_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ358153_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ855525_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
GQ855534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924613_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
GQ924629_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ924636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GU563561_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPTDHG
JN104437_HBx_P-C          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827416_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JN827417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JN827418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JN827420_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827421_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827422_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPTDHG
JQ801473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JQ801486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
JQ801508_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801510_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSPSAVPTDHG
JQ801511_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ801513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSTSAVPTDHG
JQ801519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JX507214_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803812_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
KP148549_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT235617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVSTDHG
KT307718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT307719_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT364718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPVGTLPSPSASAVPTDHG
KT364719_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT364720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT366463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KT987423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
KT987424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT987425_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
KU051425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTAHG
KU051427_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
AF223958_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ855533_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG776590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSADHG
MK171537_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHG
KR013895_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013764_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KJ997846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFETLPSPSPSAVPTDHG
KJ803761_HBx_P-C          MAARLCCQLDPARDVLWLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ598639_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KC163957_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
JQ341883_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418554_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
JN418534_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
HM011495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
GQ924604_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GQ377552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939539_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
EU916218_HBx_P-C          MAARVCCQLDPARDVLCLRPISAESRGRPVSGPFGALSSPSSSAVPADHG
EU547562_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPPSSAVPADHG
EU547559_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEXSGRPVSGPFGNLPSPSXSAVPADHG
EU305540_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ980549_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY308741_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ788835_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871973_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871974_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU939614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386645_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828916_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828919_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418546_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPANHG
JN418556_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
KJ173319_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964014_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964216_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964221_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MK171289_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171326_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171329_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAXHG
MK171360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171370_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF473543_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670274_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB115417_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSRPFGPLSSPSWSAVPADHG
LT992441_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHG
HQ700475_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPAXHG
HQ700504_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700558_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700559_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLPSPSPSAVPANHG
HQ700561_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
KP148532_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC814906_HBx_P-C          LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
GQ475350_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSTAVPADHG
GQ377536_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU859901_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JN688720_HBx_P-F          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KR811760_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148538_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC164085_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306676_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
AB697487_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JN104438_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX870000_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
HQ700567_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700566_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGTLPSPSPSAVPANHG
HQ700565_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700563_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGGLSSPSSSAVPANHG
HQ700562_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700568_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700573_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
KJ803822_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
JN104442_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750133_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924618_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSTSAVPADHG
GQ358156_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
DQ089798_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY817509_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AP011105_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AP011104_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF297620_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB201290_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
X04615_HBx_P-C            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MK171389_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPSGGLPSPSSSAVPADHG
MG826136_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MG826134_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826133_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826127_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
MG571345_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
MF674472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674454_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674386_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279275_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279249_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279247_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279246_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
KY629637_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470991_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470990_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470987_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470986_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470985_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470983_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470936_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KX765845_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KX765830_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KX765827_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPISGPFGTLPSPSSSAVPADHG
KX765824_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX765823_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KX429658_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KU964184_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964179_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU963914_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963913_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963912_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963911_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963910_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963909_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963908_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963907_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963906_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963905_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963904_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963902_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963901_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963900_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963884_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963875_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963871_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811763_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811762_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811756_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811750_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811748_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811746_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013927_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013904_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013857_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013768_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013767_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013762_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KP148574_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KP148571_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148570_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148568_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148566_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148564_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148562_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148561_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148558_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148557_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148555_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148552_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148547_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148546_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148540_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148535_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148531_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148529_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148525_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148524_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148521_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148517_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148482_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148479_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148477_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148476_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148474_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148471_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148469_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148464_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148462_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148315_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM359441_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ997841_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997816_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997815_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997811_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ803814_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803813_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803811_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803810_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGSLPSPSSSAVPADHG
KJ803759_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ410519_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173334_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173312_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173311_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173285_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF495606_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KC875271_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875267_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875264_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774231_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774228_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774220_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSTVPADHG
KC774210_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774184_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSTVPADHG
KC164151_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164150_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164149_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164148_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164147_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164146_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164145_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164144_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164143_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164142_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164141_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164140_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164139_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164138_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164137_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164136_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164135_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164134_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164133_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164132_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164131_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164130_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164129_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164128_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164127_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164126_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVRADHG
KC164125_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164124_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164123_HBx_P-C          MAAGLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164122_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164121_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164120_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164118_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164117_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164116_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164115_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164114_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164113_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164112_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164111_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164110_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164109_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164108_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164106_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164105_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164104_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164103_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164102_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164101_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164100_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164088_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164087_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164086_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSTSSSAVPADHG
JX504537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
JQ801505_HBx_P-C          MAARLCCQLDPTRNVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ801504_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGALPSPSSSAVPADHG
JQ801488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
JQ341898_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341890_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JQ040127_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JQ027318_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418552_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ924643_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPADHG
GQ924622_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPADHG
GQ855530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
FJ386625_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSTSSSAVPADHG
FJ386603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032338_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ032336_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ023656_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023653_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023647_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSPSAVPADHG
FJ023646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939558_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU670263_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU589345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306673_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGP