HBVdb

Dataset for protein HBx of genotype all

[Download (right click)] [Edit] [Sequences] [Repertoires]

12283 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774351_HBx_P-C          MAGPMGSRPEPPRGRPCIRRIGGETRGGPVSGPSGPFPSRCPCGAPGAPG
AB307829_HBx_P-C          ---RVYCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307846_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
AB307815_HBx_P-C          ---RVRCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307930_HBx_P-C          ---RLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307914_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
AB307831_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
AB307832_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307812_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307890_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307813_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307964_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB307835_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB307871_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
AB307880_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
AB307893_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSASAVPADHG
AB307885_HBx_P-C          ---RVCCQLDPARDVLCLRPLGAESRGRPFSGPFGALPSPSSSAVPADHG
AB307881_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHG
AB307875_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSCSAVPADHG
AB307888_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307887_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307843_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
AB307811_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
AB307877_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
AB307827_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB307927_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAIPADHG
AB307841_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
AB307934_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
AB307943_HBx_P-C          ---RVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPANHG
AB307959_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLPSPSSSAVPADHG
AB307850_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPLGHLPSPSSSAVPADHG
AB307911_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGTLGHLPSPPCSAVPADHG
AB307953_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
AB307946_HBx_P-C          ---RVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPADHG
AB307944_HBx_P-C          ---RVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPANHG
AB307883_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
AB307874_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPANHG
AB307873_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307852_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPANHG
AB307966_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
AB307851_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307836_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307825_HBx_P-C          ---RVSCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307816_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307963_HBx_P-C          ---RMCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB307933_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
AB307920_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB307884_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307864_HBx_P-C          ---RVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307858_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB307857_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307819_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307809_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307952_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB307955_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307956_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307898_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB307960_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307859_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307907_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307940_HBx_P-C          ---RVCCQLDLARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307915_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307967_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307901_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307896_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307929_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307948_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB307935_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307931_HBx_P-C          ---RMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307904_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307937_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307902_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB307924_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB307856_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307853_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307862_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307909_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307917_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307845_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307866_HBx_P-C          ---RMCCQLDPAPDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307906_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307908_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB307810_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
AB307923_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB307872_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307849_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307838_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307860_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307830_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSAAVPTDHG
AB307824_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB307921_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307925_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPASSAVPADYG
AB307854_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307891_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307939_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307962_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AB307957_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB307941_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSCSAVPADHG
AB307870_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307865_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307869_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307916_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307817_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307820_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307863_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307947_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307882_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307903_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307918_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307913_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307892_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSASAVPADHG
AB307919_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
AB307951_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPISRPFGPLSSPSASAVPADHG
AB307899_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AB307868_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLSSPSASAVPADHG
AB307950_HBx_P-C          ---RMCCQLDLARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
Y18856_HBx_P-RF-CB        MAARLCCQLDPARDILCLRPCGAESRGRPVSGSLGDLPSPSPS-VPADHG
Y18857_HBx_P-RF-CB        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPAFS-VPADHG
JX504531_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN688713_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ184326_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
JN664943_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
L27106_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AY741798_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB493846_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU921418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPTDHG
EU921419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT749823_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVPTDHG
JN257159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPTSAVSTDHG
JN792908_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
KC774246_HBx_P-RF-CB      MVARVCCQVDHWRDVGSLRAVGPESRGRPVSPPWGRLRSPCSFAVPADHG
KC774461_HBx_P-RF-DC      MAARSCCQLDPARDVLFLRPVAVVSGRRPVSGPDGSFRSRLCFAVPAAHG
KC774357_HBx_P-C          MAVRGCCQLDPARDVLGLRPVGVESRGRPVSGPFGHLPSLSSSAVPADHG
DQ629946_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAYPPSSPSAVPADDG
DQ899144_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899146_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899147_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899145_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
KJ638660_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADDG
KJ638662_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADNG
AB365446_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098569_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSXASAVPADHG
KY476326_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSLASAVPADNG
KJ843185_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
JF911695_HBx_P-F          MGARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPSDDG
MK183632_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098582_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPSSPSAVPADNG
AB166850_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADHG
MG098584_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGGLPPSSPSAVPSDNG
MG098578_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADYG
MG098565_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843223_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPPGGLPTSSASAVPADHG
JF911692_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911678_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
EF576812_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPSSASAVPANHG
DQ629986_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877712_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877714_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877706_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877707_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ776247_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366116_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657519_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657522_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911679_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911680_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843207_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843208_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843210_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843213_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098579_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098573_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
KJ843225_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JQ272900_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911693_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLTPSSPSAVPSDNG
JF911696_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPSSASAVPADHG
MG877708_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877721_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877722_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ823087_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823089_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026746_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026748_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366132_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098566_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843212_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098570_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
MG001259_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ823088_HBx_P-F          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
EF026747_HBx_P-F          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
EF026749_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF576808_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
FJ657528_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
HE981181_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JN688701_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823090_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026745_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365449_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365450_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AF223962_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
AF223965_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ629958_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823086_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877715_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877716_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877717_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
X75658_HBx_C-F            MAARMCCQLDPARDVLCLRPVGAESSGRTLPGPLGALPPSSASAVPADHG
MG098574_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098575_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098583_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098580_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098577_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098564_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KY382411_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KX264499_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843226_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843224_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843222_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843221_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843220_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843219_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843211_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843209_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843189_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843175_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ676694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPXBDG
KC494398_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JX079937_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JQ272906_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN811656_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN811655_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183636_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183635_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPSSASAVPADHG
MK183633_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183630_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877705_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVXADHG
MG877704_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVXADHG
JN688709_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADXG
MK808040_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183647_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183645_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183644_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183641_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183640_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183639_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183638_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183631_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183643_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877703_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVXADHG
MK183637_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB205010_HBx_P-H          MAARMCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPAVDG
HM117851_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB275308_HBx_P-H          MADRLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998719_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998723_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
MT622523_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPANNG
KM998720_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPTDDG
AY090454_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDR
AB059659_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB179747_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB266536_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB353764_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPPSSPPVVPADDG
AB375159_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
AB375160_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
KY458060_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KY458059_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KX264501_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998721_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998718_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
HM117850_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSFGALPPSSPPAVPADDG
HM066946_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356716_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356715_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
EU498228_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
EF157291_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090460_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090457_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDG
AB818694_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB375164_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB375163_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375161_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375162_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059660_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059661_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KP995104_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPFFPSTVPADDG
DQ629996_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSRSLGAVPPPLPSATPADDG
DQ629991_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629941_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVSPHLPSAVPADDG
DQ629937_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
KC494401_HBx_P-F          MAARLCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494396_HBx_P-F          MAARMCCKLDTARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494394_HBx_P-F          MAARMCCKLDPERDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494399_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995120_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494405_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KJ843191_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494395_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494397_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
X69798_HBx_P-F            MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995110_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494402_HBx_P-F          MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494403_HBx_P-F          MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629995_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629967_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPRPLGAIPPSSPSAVPANDG
DQ629965_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629934_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629956_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPPSPSAVPANDG
AY090455_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
DQ629933_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629940_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629950_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629953_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629954_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629997_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
AY311369_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSTVQAYDG
KX264497_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899142_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899143_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629936_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLRGPLGAIPPSSPSAVPANDG
AB064315_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPANDG
DQ629985_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629930_HBx_P-F          MAARLCCQLGPPRDGLYLHPVGADSRGRSLSGSLGVVPHPSQSAVPADDG
KP995107_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995114_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPPGAVPPSSPSAVPADDG
KP995115_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPIGAVPPSSPSAVPADDG
KP995113_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGDVPPSSPSAVPADDG
KP995105_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995097_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGSLGAVPPSSPSAVPADDG
DQ629947_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KJ638664_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPPDDG
DQ629993_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KP995101_HBx_P-F          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718107_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSSSAVPADDG
KJ843196_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843199_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843195_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843163_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272894_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAISPPSPSAVPADDG
JF911673_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
HM622135_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629944_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRFLSGSLGVVPPPSPSAVPADDG
DQ629935_HBx_P-F          MAARLCCQMDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KT896494_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
FJ589065_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSFGAVSPPSPSAVPANDG
AB116552_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
AF223964_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AY179735_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823092_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823093_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823094_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823095_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026751_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026752_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026753_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026754_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EU366118_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ657529_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709457_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
FJ709458_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709459_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709460_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709462_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709463_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709464_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709465_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709494_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981182_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981183_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585187_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585188_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585189_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585190_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585191_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585192_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585193_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585195_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585196_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585197_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585198_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSTVPADDG
HM585199_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM590473_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HQ378247_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911674_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911675_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911676_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911677_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN688691_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688699_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688703_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JQ272889_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272890_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272891_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272893_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272895_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272898_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272899_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272901_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272904_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272905_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272907_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272908_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272909_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272910_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272913_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272914_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KC494400_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KC494404_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ586805_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586806_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586807_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586808_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843167_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843171_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
KJ843174_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843176_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843179_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843180_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843190_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843197_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843198_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843200_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843201_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843203_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843206_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM998715_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995116_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KX264496_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382415_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458061_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458062_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPANDG
MF593354_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593367_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MK058437_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
MK808039_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
OK106257_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AB064316_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AF223963_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823091_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF026750_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EU366133_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843164_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843168_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843169_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843170_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843181_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843193_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843194_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843204_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382416_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593356_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593360_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593376_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593380_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995118_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGAVPPPSSSAVPADNG
KP995098_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
KP718110_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM233681_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
KJ843202_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792920_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585200_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
FJ589067_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
EU670261_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF397982_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
DQ899148_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADHG
DQ629989_HBx_P-F          MAARLCFQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629978_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629960_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSSSAVPADDG
DQ629959_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
DQ629943_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629932_HBx_P-F          MAAGMCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB036910_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADHG
MH051986_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MH051987_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KJ843205_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382417_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MG001258_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585194_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
HM627320_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
FJ657525_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MG877700_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629951_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629955_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629981_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629994_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB116654_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPSSPSAVPADDG
DQ629977_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629988_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSTSAVPADDG
AB116551_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
DQ899149_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718112_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
AB036914_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036915_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036916_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036917_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036918_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036919_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036911_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
AB036920_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
KP718103_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPPSSSAVPADDG
AB036905_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036906_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036907_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036908_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036909_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036912_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036913_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB116549_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB116550_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AY311370_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
DQ899150_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KJ638663_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AB086397_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090456_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629962_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629968_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629972_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
DQ629974_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629979_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629990_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629992_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
EU670260_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792914_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792916_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792917_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792918_HBx_P-F          MAARLCCQLDPTRDVLCLRPVRAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792919_HBx_P-F          MAARLCCQLDPTRDVLCLRTVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792922_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JX079936_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638656_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638657_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPABDG
KY476324_HBx_P-F          MAARLYCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
KY476325_HBx_P-F          MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476327_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476328_HBx_P-F          MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476330_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476331_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
X75663_HBx_P-F            MAARLCCQLDPARDVLCLRPVGAESSGRTLPGSLGAVPPPSSSAVPADNG
KY476329_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629938_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AY090458_HBx_C-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
AY090459_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090461_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
DQ629931_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629945_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629948_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629949_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629961_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629963_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629964_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629966_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629969_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629971_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629973_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629987_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
EU670262_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585186_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590471_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590472_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590474_HBx_P-F          MAAWLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
JQ272892_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843177_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843178_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP718104_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP718113_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995126_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSPGAVPPPSSSAVPADDG
KP995109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MF593371_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRPLSGSLGAVSPPSPSAVPADDG
KY476332_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476323_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476322_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX757663_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPXSGSFGAVSPPSPSAVPANDG
KX264498_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
KP995125_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995124_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
KP995123_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995119_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVSPPSSSAVPADDG
KM659861_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
FJ589066_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KJ638659_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX757665_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGSFGAVSPPSPSAVPANDG
KP995117_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGAVPPPSSSAVPADDG
KP718111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KC774196_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC774336_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
EU054331_HBx_C-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHG
KC774475_HBx_P-RF-DC      MAARVFCQLDPAGDVLCLRPVAVVSRRWPMSGPVGSFRSPSSFAVPANHG
KC163999_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC774244_HBx_P-C          MVARVCCQVDHARDVLSLRPVGAESRGRPISGPFGTLRSHCSFAVPADHG
EU939637_HBx_P-B          MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHG
KC774368_HBx_P-B          MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHG
AB100695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHG
KC774180_HBx_P-C          MVPRVCGQLDPARDVRCLRPVGPESRGPPVSRPLGPLWSPFSFAVPANRG
KC774445_HBx_P-D          MAVRLCCQLDRARDVLCLRPVGAESRGRPFSGPLGILLSLCPFAVSSDPG
KC774227_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFLFAVPTDHG
MH488840_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774200_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPTLFAVPADHG
KC774271_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPTDHG
EU939542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899767_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPVVPTDHG
AB112065_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
KJ803795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KR811476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRSVSGPLGDLPSPSSSAGPADHG
HM750131_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPISGPFGSLPSPPSSALPADHG
MK171606_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
KR812039_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812038_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KR811977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811979_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811976_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812026_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812028_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812029_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812031_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812036_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812035_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM363606_HBx_P-E          MAARLCCQLAPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
JN040822_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSADHG
JN040782_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSSDHG
GQ922003_HBx_P-D          MAARLCCQLDPARDXLCLRPLSAESRGRPXSGPLGPLSSSSLPAVPTDHG
KY881821_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAECSEGHSTGTLRALPPASPSVVQTEHG
DQ993702_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHG
KC315400_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
GQ205379_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGSLSSSPPSAVPTDHG
HM363605_HBx_P-E          MAARLCCQLDPARDVLCIRPVSAESCGRPISGSLGDLPSPSPSAVPAVHG
MK052948_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052951_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MG776612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776392_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFAGPLGTFSSPSPSAVSTDHG
GQ922005_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPLGPLSSSSLPAVPPDHG
GQ922004_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPISXPLGSLSSSSLPAVPTNHG
AB555497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
AB555500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
KU964189_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964190_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964191_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964192_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964199_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KC774217_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
KC774432_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
FJ386624_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
GQ372968_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
DQ089797_HBx_P-C          MAGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
AY217364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHG
HQ700520_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPLGTLPSPSSPAVPAHHG
AB915178_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY796031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGIFSSPSPSAVSSDHG
FJ787441_HBx_P-C          MAARMCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPLVPTDHG
JQ707510_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707498_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707509_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707497_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707491_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707511_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707477_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707492_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707495_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707501_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707504_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JN574728_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JN664941_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSSSAVSSDHG
KM524352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KM524355_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KX423721_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JQ707493_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRPSPSPSAVSSDHG
JQ707506_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618423_HBx_P-D          MAARLCCQLDPPRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618425_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MN066401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
KP168416_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGVESCGRPVSGPLGAFSSPSLPAVPTDHG
HQ700531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HM146131_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
FN545827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
MT603395_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSSDHG
MG776379_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776491_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
JN642167_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFSSPSPSAVSTDHG
FJ904439_HBx_P-D          MAARLCCQLDPTRDVLCLRPLGAESCGRPFSGPLGDLSSSSLPAVPADHG
AY161158_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AB674415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSSDHG
AB555501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSSDHG
AB555496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPHPFAVSSDHG
KP148473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC774290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023677_HBx_P-C          MAARLCCQLDPTRDILCLRPVGAESSGRPLSGPLGDLPSPSSSAVPAIHG
MN689123_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
MK171290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPLLPTBHG
JQ341831_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHG
JQ341813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHG
AP011093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHG
AB048705_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDG
MN066381_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ803788_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGSLGALPAASSSAVSTDHG
HQ700494_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGXLGXLSSPSLPAVPADHG
GQ331048_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
AP011108_HBx_P-RF-CB      MAARLCCQLDTSRDVLCLRPVGAESRGRPVSGPFVPLPSSSSSAVPADHG
MH580648_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580640_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580641_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580626_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCRRPVSGSLGDLSSPSPSAVPADHG
MG776503_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161757_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494706_HBx_P-E          MAARLCCQLDPARDVLCLRPVSVESCGRPVSGSLGDLSSPSPSAVPADHG
AM494699_HBx_P-E          MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967528_HBx_P-E          MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSFGDLSSPSPSAVPADHG
X59795_HBx_P-D            MAARLCCQLDPERDVLRLRPVGAESSGRPFSGPLGTLSSPSPSAVSSDHG
MW601325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601261_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097741_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MN182685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSSDHG
MG776792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSASAVPPNHG
MG776578_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSASAVSTDHG
KC875311_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JQ707476_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707478_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707479_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707480_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707481_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707482_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707484_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707485_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707487_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707488_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707489_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTRSSPSPSAVSSDHG
JQ707490_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707494_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707496_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707499_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707500_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707502_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707503_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707505_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707507_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707508_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSSSAVSSDHG
JF754608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097866_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KU963992_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963996_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963997_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964002_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963990_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963991_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963993_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963994_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963995_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963998_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963999_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964001_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964003_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KR014013_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPATHG
KR013852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013853_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013815_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFETLPSPSSSAVPADHG
KJ803774_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSTVPAAHG
KJ173395_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173317_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KC774309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSLSAVPADHG
KC774262_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSSSAVPADHG
KC163954_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGTLPSPSSSAVPADHG
JX661493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504541_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
JX429916_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KC774192_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
GQ377529_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGAIPSPSPSAVPADHG
GQ377527_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPSGSLPSPSSSAVPADHG
KJ173287_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ358158_HBx_C-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSRSLGTLPSPSSSAVPADHG
GQ358157_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRSVSGPLGVVPSPSPSAVPAAHG
FJ787454_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPADHG
KJ173305_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHG
KJ173306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHG
FJ562255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ386662_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHG
FJ386597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
EU916210_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
KR013915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGQPVSGSLGTLPSPSSSAVPADHG
KR013919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSSSAVPANHG
EU589340_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589341_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589342_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ562276_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ787481_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU570067_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306690_HBx_P-C          MAARPCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
AY057947_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF326587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF182803_HBx_P-C          MAARMWCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871969_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB670261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB485808_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPTDHG
AB367410_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB362932_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774315_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB106895_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB050018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KC774310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSDSAVPADHG
KJ173291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KR013812_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFGTLPSPSSSAVPADHG
MN689117_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK171413_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVIPTVNG
KP406170_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KP148317_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803820_HBx_P-B          MAARLCCQLDTARNVLCLRPVGAESRGRPLPGSLGALPPASPPAVPTDHG
KJ803768_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562312_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562262_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448627_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU859952_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
GQ331047_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
EU939579_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
FJ899774_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
EU562215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562216_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562217_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPEPFGPLSSPSSSAVPADHG
GQ475338_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSTVPADHG
AB367395_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
JQ040144_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363281_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU306685_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306687_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306688_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306689_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306691_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
MK171452_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGDLPSPSFSAVPADHG
JN104440_HBx_P-C          VAARLCCKLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSSSTVPADHG
KJ470887_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSLPAVPADHG
KF873530_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAEPRGRPVSGPLGDLXSPSSPAVPADHG
GQ161754_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904407_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFGAESCGRPFSGPLGDLSSSSLPAVPADHG
HM363609_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AM494691_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW601270_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSSDHG
MN182664_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFSSPSPSAVSSDHG
MN066389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAASSDHG
MG776781_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSADHG
MG776581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KU668439_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KT235621_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
KM524341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JQ032005_HBx_P-D          MAARLCCQLVPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JN574723_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GU456643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSTDHG
AB119252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524346_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524351_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KT366465_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925364_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103283_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK534557_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MF925378_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTLPSPSSSAVPTDHG
KF873520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
JQ040152_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESGGRPVSGPFGSLPSASSSAVPADHG
FJ023641_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
FJ023658_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
GQ855523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPPDHG
GQ855548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JN418500_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JQ801520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JQ801523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
MH488812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG826152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
MF674427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVLPTDHG
KX276788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148345_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KC774397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHG
KC774375_HBx_P-B          MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHG
JX870001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHG
JX661479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
JX429897_HBx_P-B          MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
DQ995805_HBx_P-B          MAARLCCQLDHARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MF925379_HBx_P-D          MAARLFCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPTVHG
MK534680_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLRALPPASPSAVPTDHG
JX661482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
EU939638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AB073839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
AB674431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MN689119_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK818223_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK171644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
MK171603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK171403_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTSSPPVVPTDHG
MK171285_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488848_HBx_P-B          MAAGLCCQLDPARNVLCLRPVGAESRGRPLPGSLGALPPATPPGVPTDHG
MG571354_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGALPPASPPVVPTDHG
MF674420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
KY881866_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881864_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276812_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KX276777_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963955_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963952_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963951_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963950_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963949_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963948_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963947_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963946_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KM875418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM359440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803817_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ173423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ173422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ173421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ173420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KC774419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX504533_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
JQ801507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQR
JQ341838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
JQ341814_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHG
JQ040171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
GU451682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHG
GQ377612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
EU547563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
X97850_HBx_P-B            MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPAVPTDHG
MZ671236_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MT426102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
MK534676_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK171613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
MK171292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488836_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MH488816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPRLPTDHG
MG571347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571338_HBx_P-B          MAARLCCQLDPARDVLCLRPVDDESRGRPLPGPLGALPPASPPVVPTDHG
MF674485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
KX276802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPGVPTDHG
KX276792_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276781_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964151_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964150_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964149_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964148_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964147_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964146_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964145_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964144_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964143_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964142_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964141_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964140_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964139_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP036970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM392072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213036_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774383_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507215_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707766_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707762_HBx_P-B          MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707753_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707746_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707745_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707740_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ341817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027329_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JQ027330_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803802_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803782_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
MT111595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPVVPTDHG
MN733921_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK171638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSVVPTDHG
MK171396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGQPLPGPLGALPPASPPVVPTDHG
MH488856_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH488855_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH488853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488820_HBx_P-B          MAAWLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571351_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MG571331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVPTDHG
KX276830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVSTDHG
KX276811_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
KJ803756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645056_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534734_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534729_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534728_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534715_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534714_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534706_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
X98077_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645005_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
MK818222_HBx_P-B          MAARLCCQLDPARDVXCLRPVGAESRGRPLPGPLGALPPASPPAVPTBHG
MK534732_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
MK534727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534692_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
MK534691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MK534599_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
MK171587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171545_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH663473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
MH488842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MH488833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
MH488813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571376_HBx_P-B          MAARLYCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
MG571361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571353_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG372436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KY881865_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPVSPPVVPTDHG
KY881849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881833_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881830_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881828_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPPVPTDHG
KY470841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KX276829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPASPSAVPTDHG
KU964168_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964167_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964166_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964165_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964164_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964163_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964162_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964161_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964160_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964159_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964158_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964157_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964156_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964155_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964154_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU963853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148366_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148365_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148364_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148363_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148362_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148361_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148360_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148359_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148357_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148356_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148335_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148334_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148333_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148332_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148331_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148330_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148329_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALSPASPPVVPTDHG
KP148328_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148327_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148326_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148325_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148324_HBx_P-B          MAARLCCQLGPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148323_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148322_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148321_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148320_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148319_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148318_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148314_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KM875417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KM875416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KJ803763_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ410517_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ410490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173345_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC774415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHG
KC774412_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC315393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX869999_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX869998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
JX661478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504538_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX429908_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ801479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341827_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
JQ341822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHG
JQ341810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040157_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ040125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN827419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM153811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
HM011503_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF436923_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MZ671239_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MZ671238_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MT426100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK171598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171501_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK171364_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHE
MH488826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH061283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPIVPTDHG
MG571368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPASPPVVPTDHG
MG571366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPTSPPVVPTDHG
MG571350_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MG571342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571333_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571328_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571324_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571322_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
MF674450_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674449_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MF674426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KX429647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276801_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276791_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KX276774_HBx_P-B          MAXRLCCQLDPARDVLCLRPVGAESRGRPLXGXLGALPPASPPVVPTDHG
JQ341800_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KX276818_HBx_P-B          MAARLCCQLDPARDVLCLRPXXAESRGRPLPGXLGALPPASPPAVPTDHG
KX276790_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTXHG
JX507213_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
KX276779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276804_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
HM011478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276806_HBx_P-B          MAARLCCQLDXARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963953_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963957_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963958_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963959_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
FN545841_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
MH580614_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580615_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580616_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580618_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580619_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580620_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580623_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580651_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
FN545842_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
KU736903_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915177_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPANHG
AM494690_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494693_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494697_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494701_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGALSSPSPSAVPADHG
AM494702_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494703_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494704_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494707_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494708_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494709_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494710_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494713_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494715_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494717_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594766_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363569_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363570_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363571_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363572_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363573_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KU736893_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736900_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736901_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736902_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
KU736905_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736906_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736907_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736908_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736910_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736911_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736912_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736913_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776403_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776512_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776678_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776737_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776798_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776799_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580617_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580628_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580630_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580644_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580650_HBx_P-E          MAARLCCQLDPARDVLCLRPVNAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507846_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507848_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967529_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X75657_HBx_P-E            MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594767_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPANHG
AM494705_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU679953_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KT003704_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPAPHG
KJ803804_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPIGAESRGRPLSGPFGTLPSPSSSAVPADHG
KF873522_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
HQ700554_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGDLPSPSSSAVPANYG
HQ700532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HQ700519_HBx_P-RF-CB      MAARLCCQLDTTRDVLCLRPVGAESSGRSVSGPLGDLSSPSPPAVPADHG
HQ700500_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
GU357843_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023667_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPFGDLPSPSPSAVPAVHG
EU833891_HBx_P-RF-GC      MAARLCCQLDHARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
AP011102_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGGLPSPSSSAVPADHG
KU736904_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X97849_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097798_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
MZ097742_HBx_P-D          MAARLCCQLDXARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MZ097674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLPSPSPSAVSSDHG
MW601262_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MN182670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MG776527_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF925391_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSADHG
MF925390_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
KY629634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ687530_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
JN664931_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSHHG
GU456684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ477458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AB270543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF674430_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KP148560_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ173286_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF873516_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KC774333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774316_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPANHG
HQ700570_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700490_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700456_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPATHG
HQ700522_HBx_P-C          MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
HQ700543_HBx_P-C          MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
KU679948_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLAALPSPSSSAVPADHG
KU679944_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
HQ700536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700533_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700507_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
FR714490_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
FJ904444_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPADHG
FJ904408_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904404_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
AY057948_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
AB105172_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGDLPSPTSSAVPANHG
KF849718_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
MW601337_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MG776715_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSADHG
MG776476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAISTDHG
JN664932_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN664918_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN642134_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270540_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB116266_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSSDHG
AB110075_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109475_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB078033_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB078032_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB078031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
MF925405_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925398_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925387_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925374_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925369_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
KR811747_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFSSAVPADHG
KR013856_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148545_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ410513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163964_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163963_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163962_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163955_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163948_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700502_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
HQ700476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
FJ023654_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KU679959_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
MN066390_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KR811578_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
KU679952_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVXRPLGDLPSPSSPAVPADHG
KP288875_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KP148352_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ803798_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ647356_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ470890_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470888_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470886_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470884_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSLPAVPADHG
KF873534_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873533_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873524_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KF873517_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873515_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873513_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873511_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
JN642152_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642141_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700585_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700584_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700583_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700582_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700581_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700579_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700560_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700541_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700540_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700537_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700535_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700534_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700530_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPADHG
HQ700528_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HQ700525_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPAXHG
HQ700524_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700523_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPIGDLPSPSSSAVPADHG
HQ700509_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSLSAVPADHG
HQ700508_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
HQ700505_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPPGDLPSPSLPAVPADHG
HQ700503_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700501_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700497_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700493_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPANHG
FJ904447_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904437_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPADHG
FJ904414_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904405_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPANHG
FJ904403_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGDLSSSSLPAVPADHG
FJ904394_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ361772_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSPSAVPANHG
AF297619_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
AB188243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB033559_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
MZ097861_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097731_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALSSPSPYAVSADHG
MZ097723_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601247_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALSSPSPYAVSADHG
MW601239_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KJ470893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
FJ904422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
X75665_HBx_P-C            MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSLSAVPANHG
MK171315_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
MG826131_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MF674435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674429_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSPAVPADHG
KR811459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148512_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ803815_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ410504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGSLPSPSSSAVPADHG
KF873514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEPRGRPFSGPLGALPSPSSSAVPADHG
KC774325_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSRPFGTLPSPSPSAVPADHG
KC164089_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026888_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPADHG
JQ707773_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700521_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESGGRSVSGPLGDLPSPSPPTVPADHG
HQ700462_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPPSSAVPANHG
FJ023665_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023664_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPFGDLPSPSPSAVPAVHG
EU835240_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSSAVPAVHG
DQ478890_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLPSPSSSAVPADHG
FJ023674_HBx_P-G          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPVGDLPSPSPSAVPAXHG
HM363583_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363582_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
MZ097782_HBx_P-D          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSTDNG
KX276857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
FJ904435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGDLSSSSLPAVPADHG
KU679957_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KU679949_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESRGRPFSGPLGALPSPSSSAVPADHG
KU679947_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KJ410518_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700555_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
KU679955_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPXSSAVPADHG
KU679950_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679946_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679941_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KU679939_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPPSSAVPADHG
KU519423_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KJ410506_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLPSPSSSAVPADHG
KF873521_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
JN104442_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750133_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924618_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSTSAVPADHG
AY817509_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AP011104_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF297620_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB201290_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
KY629633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
X04615_HBx_P-C            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JQ341887_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPADHG
KU679940_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873535_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873523_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXVPSPSSSTVPADHG
HQ700518_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRSVGAESRGRPVSGPLGDLPSPSSPAVPADHG
GQ358155_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSSSSSAVPADHG
AP011103_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPAAHG
AB493847_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493840_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
AB493838_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493837_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPTGALPSPSSSAVPADHG
MW887650_HBx_P-C          MAARLCCQLDPARDVLXLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU679960_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPPGDLPSPSSSTVPADHG
KU679937_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDXPSPSSSAVPAXHG
JQ341895_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341875_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
HQ700578_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGTLPSPSPSAVPANHG
HQ700572_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
KU679942_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
HQ700576_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDXPSPSXSAVPANHG
KF873519_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873518_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
HQ700557_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700485_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
KU679936_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HQ700577_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLXSPSXXAVPANHG
HQ700575_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLSSPSPSAVPANHG
KF873544_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
FJ023666_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023668_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023670_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023673_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882611_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882612_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882613_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
KC163966_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163967_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163968_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163969_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163970_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163971_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163972_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163973_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163974_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163975_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163976_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163977_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163978_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163979_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AB120308_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB205126_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210822_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB267090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB471856_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB471857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103275_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHG
EF594773_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
GQ183471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183475_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHG
GQ183479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183485_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ924652_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN574729_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN664927_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
JQ687531_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSSDHG
KC875310_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679994_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679996_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679997_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679998_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524344_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KM524353_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524354_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KR905424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN642157_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP995100_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF324347_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU439010_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014386_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014397_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026811_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026812_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026813_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026814_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026815_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB033550_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198078_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198079_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB198081_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198082_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
AB205124_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB222714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB299858_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB426467_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471851_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471853_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB640730_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB642100_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670247_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670267_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB222715_HBx_P-C          HAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
KC774214_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774334_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367412_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418555_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670249_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171303_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
AB033551_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAAHG
AB033553_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB033556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSSSAVPADHG
FJ386576_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY251137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
GQ377543_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774312_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT364752_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774431_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHG
KJ598778_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ787485_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ562273_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
EU939617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939560_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF326585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326586_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ377528_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ475311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPTDHG
JX429905_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSTVPTDHG
JX429917_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX504544_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774202_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774274_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPTDHG
KC774303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
KJ803800_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
AF325701_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670278_HBx_P-C          MAARMCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLPSPSSSAVPADHG
AB033552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB014364_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014377_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB014378_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPADHG
AB014394_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB111114_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367401_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367430_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPANHG
AB367435_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB642095_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB642097_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670238_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSTSAVPADHG
AB670242_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670256_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
HQ700529_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPLGDLPSPSPSAVPADHG
GQ475337_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475320_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ377628_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787487_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787483_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787482_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787479_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787439_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562325_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSISAVPADHG
FJ562304_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562269_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386672_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPFSGPFGPLSSPSASAVPANHG
FJ386592_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939642_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPIGSLPSPSSSAVPADHG
EU939568_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
DQ089795_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028298_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325700_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325199_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670304_HBx_P-C          MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670295_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670268_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670277_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475335_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
EU787435_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
MW887647_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964226_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964225_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964223_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964220_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964217_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475356_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ872211_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB365451_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367427_HBx_P-C          MAARMCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU717218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562331_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
KF018208_HBx_P-D          MAARVCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KR013794_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KC774359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700564_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
AB670258_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964028_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964049_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964050_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964051_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964052_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964053_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964054_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964055_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964056_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964057_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964058_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964059_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964060_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964061_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964062_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964063_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
FJ562332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HM750132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774439_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774223_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774241_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB933282_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB933283_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPXDHG
JQ707469_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPFPSAVPADHG
JQ707468_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU833889_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707421_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707424_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707426_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707430_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707432_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707441_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707448_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707450_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707456_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707457_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707458_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707459_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707460_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707461_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707462_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707463_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707464_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707465_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707466_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPIGTLSSPSPSAVPADHG
JQ707467_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707470_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707471_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707472_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707473_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707475_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707445_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EF464097_HBx_P-G          MAARLCCHIDPFRDVLCLRPVSVESSGRPLLGSFGDLSPPSPSAVPADHG
KR811785_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811774_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056514_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSTPSPFAVPADHG
JQ272887_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EU833890_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
MT426120_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811794_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811793_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811783_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811780_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811775_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811767_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811460_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811461_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811765_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811768_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811770_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811771_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811772_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811773_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811776_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811777_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSTVPADHG
KR811781_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811782_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811784_HBx_P-G          MAARLCCQLDPSRDVPCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811786_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811788_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811789_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811790_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811791_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811792_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811795_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811797_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811800_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811802_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811804_HBx_P-G          MAARLCCQLDPTRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811806_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811807_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KM998716_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767451_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707677_HBx_P-G          MAARLCCQLDPSRDVLCLRPDSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707657_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707660_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707666_HBx_P-G          MAARLCCHLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707668_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707671_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707673_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707678_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707679_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707680_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPAAHG
GU563556_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF219922_HBx_P-RF-GH      VAAGLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707436_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KJ194508_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056513_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056515_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056516_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064310_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064312_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375165_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375166_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375167_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375168_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375169_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375170_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF160501_HBx_C-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF405706_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
DQ207798_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF464098_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF634480_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
GU565217_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981171_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981172_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981174_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
HE981175_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981176_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF414679_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767450_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767452_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR230749_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX264500_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KY004111_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933279_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933280_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933281_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981179_HBx_P-RF-FG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981180_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHE
JQ272886_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KP274926_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064311_HBx_P-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064313_HBx_C-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB205121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU522067_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ787475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB555499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KR812015_HBx_P-B          MAARPCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KC814918_HBx_P-B          MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026883_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ386668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB106884_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHG
KC510659_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510646_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510653_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC774369_HBx_P-B          MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHG
KC814890_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814917_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPTSPPAVPTDHG
MH488811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPIVPTDHG
MG571326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571329_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774382_HBx_P-B          MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPG
JX504532_HBx_P-B          MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHG
GQ358144_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHG
AB073850_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHG
GQ924651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ924654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ358146_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ358147_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
KJ803772_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPSAVSTDNG
MK171366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDYG
MH488845_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
JX661470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYG
GQ358145_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHG
EU881997_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
D23678_HBx_P-B            MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHG
AY033072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY033073_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AB931168_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AB931169_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AB073849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AB010290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHG
AB900106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHG
MF674392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAAPPSAVPPDHG
KP148369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KP148451_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KC814875_HBx_P-B          FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
GQ924656_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ475340_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
EU939661_HBx_P-B          MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AB073856_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
KC510652_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510644_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
FJ032342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
GU815723_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ386674_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032344_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF925392_HBx_P-RF-DB      MAARLFHSLAAARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK171599_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674410_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVSTDHG
KY881946_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPSAVPTDHG
KY881945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881947_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY629636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGVESRRRPLPGPLGALPTASPSAVPTNHG
KC774418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHG
KC774416_HBx_P-B          MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KC510651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510648_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
JQ341798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
JQ040173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
GU815732_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHG
GU815726_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815724_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHG
GQ855529_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815722_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815725_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815728_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815730_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815731_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815740_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815741_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815742_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815743_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815744_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815745_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815746_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ377561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562303_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386648_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHG
FJ023638_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHG
EU881998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU589335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU570075_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHG
EF134946_HBx_P-B          MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993704_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448621_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY800391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
AY800392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
AY217361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
AY167094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY596104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AJ627225_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
JQ341823_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHG
AF282918_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
X97851_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AF282917_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHG
AB900108_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB368295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHG
AB302942_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302943_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB241116_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB241117_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB010289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
LC349879_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
KX276828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
JQ341843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHG
D00329_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB642101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB828708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
MG571346_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881839_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KX429622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KU964301_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
KP148344_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDYG
KP148339_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KM875420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ790200_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KC510657_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHG
KC510656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
JX661483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYG
JQ027311_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHG
HQ700548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHG
GU815727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRG
GQ924624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHG
GQ377638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
GQ358143_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
FJ032354_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHG
EU939633_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EF134945_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHG
DQ993700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
AY800389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AY217355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHG
AF121247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHG
AB900105_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB302945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHG
AB073832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHG
AB205119_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB246340_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB365445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB642094_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
AP011084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHG
AP011096_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY163869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY163870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY167089_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
AY596112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
DQ377158_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ448620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ448622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386646_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPADHG
MT645001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MK534659_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK171632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPPDHG
MK171528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAAPPVVPTDHG
MK171343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGPESRGRPLPGPLGALPPASPPVVPTDHG
MF674440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881955_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881845_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KY881823_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KP148426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDRG
KP148338_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ803825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPASPHLVPTDHG
KJ803796_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KJ173351_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYG
KC774362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPG
JQ429081_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
HQ700546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
GU815770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815685_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ924640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU939634_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
DQ993696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900107_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHG
AB073844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHG
KR812017_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
EU939629_HBx_P-RF-BC      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MZ675807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MZ675795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MT645041_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MT426104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
MN733920_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
MK534704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSVLPTDHG
MK534698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSVLPTDHG
MK534697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPTDHG
MK534612_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534608_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK171515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVLPTDHG
MK171409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
MK171306_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVLPTDHG
MH488851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488843_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVSTDHG
MG571373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571371_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
MG571370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674456_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPATPSAVPTDHG
MF674424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674382_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
M54923_HBx_P-B            MAARLCCQLDPARDVLCLRSVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349868_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPADHG
KY881951_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881950_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881949_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881948_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881902_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881863_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881860_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881837_HBx_P-B          MTARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KX765856_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPGIPTDHG
KX429630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPXSPSXVPTDHG
KX276783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KU964264_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964261_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964260_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964259_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964258_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964257_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964097_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964096_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KP148372_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KJ410502_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173384_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHG
KJ173355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173354_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KC774390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHG
KC510660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC510654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC163809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHG
JX661481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHG
JQ707758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
JQ341833_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHG
HM011476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
HM011470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
FJ562236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHG
FJ023636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU882004_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882003_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU796071_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU139543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHG
EF473977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
DQ995804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AP011094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AB555498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB073843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB073831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHG
MK534587_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148337_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
HQ684848_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645058_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MT645057_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MT645016_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MK534614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK534591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534572_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLGALPPAAPPVLPTDHG
MK171589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGVLPPASPPSLPTDHG
MK171372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052964_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK052962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MH488832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF674470_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPADHG
MF059700_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059694_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059620_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
LC416037_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
LC349877_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KY881856_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881843_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY629635_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KX429631_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276817_HBx_P-B          MAARLCCQLDPARBVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KU964302_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964300_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964299_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964296_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964294_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964293_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964288_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964287_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964137_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148435_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148429_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148394_HBx_P-B          MAARLCCQLDPARYVLCLRPVGAESRGQPLPGPLGALPPASPSAVPTDHG
KP148392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148383_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAGSRGRPLPGPLGALPPASPSAVPTDHG
KP148349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148346_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADYG
KP148342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDYG
KP148341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148340_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KM213032_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ843165_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ173353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYG
KJ173340_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KJ173339_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KC774395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC163815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026879_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHG
JQ801474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707757_HBx_P-B          MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ429079_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHG
HM011471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HM011467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
GU815783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815782_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815780_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815778_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815777_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815776_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815774_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815772_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815771_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815769_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815768_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815767_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815766_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815765_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815762_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815761_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815760_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815757_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815754_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815753_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815751_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815750_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815749_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815748_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815747_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815729_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815721_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815720_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815719_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815718_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815717_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815716_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815715_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815713_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815692_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
GU815691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU357842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHG
GQ924637_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924631_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
FJ751769_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562321_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ562253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562234_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
FJ562231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ518811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
FJ386684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ386683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ023633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHG
EU939673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939636_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU882002_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU796068_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796067_HBx_P-B          MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU487257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU306695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
EU043345_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043344_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043342_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473973_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EF473972_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
DQ993709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AY206375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MW887648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPADHG
MK534575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171420_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171304_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHPVPTDHG
MF674465_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPAVPTDHG
MF674464_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674446_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059719_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059609_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
LC349870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC349869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881899_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881862_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KY881842_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881841_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881838_HBx_P-B          MAARLYCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLVPTDHG
KY881836_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881834_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881831_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881827_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881826_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881824_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881822_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881820_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY470961_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY470960_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY470953_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KX276823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276800_HBx_P-B          MAARLXCQLDXARBVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276771_HBx_P-B          MAARLCCQLDPARDVLCLRXVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964286_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964285_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964282_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964281_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964280_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964279_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964278_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964277_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964276_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964275_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964274_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964272_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KP148406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KM213034_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803824_HBx_P-B          MAARLCCQLDPSRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ410500_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ173410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
KC774394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHG
KC774376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHG
KC492740_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC492739_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JX661473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHG
JX429900_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
JX429899_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHG
JQ801471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ993687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
MK534717_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534716_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534712_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534684_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534660_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534594_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF925402_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925382_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925370_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803803_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803778_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173358_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
EU939631_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660227_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF233236_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OK106254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MZ675806_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ675805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ675794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ675785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
MW310263_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW310262_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645025_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT426103_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
MN733922_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MK534733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534694_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPLVPTDHG
MK534693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171592_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171536_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171523_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
MK171499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171486_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MK171482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MK171448_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK171369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH932712_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPSAVPTDHG
MH488846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488841_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG826153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MG571363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MG571358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MG571336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MG571327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MF674509_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSTVPTDHG
MF674506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674503_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674488_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPVPTDHG
MF674460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MF674421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
MF674384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF621878_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059732_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059731_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059730_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059729_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059728_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059726_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059724_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059723_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059722_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059721_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059720_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059718_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059717_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059716_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059715_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059714_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059713_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059692_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059690_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059685_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059671_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059665_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059662_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059659_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059657_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059653_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059645_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059637_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059631_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059618_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059615_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059607_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059604_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059599_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059597_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059596_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059594_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059593_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059592_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059590_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059586_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059585_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059580_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059577_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059572_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059565_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059564_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059560_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059557_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF059553_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059550_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059549_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059545_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059544_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059542_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059541_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059540_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059539_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059538_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059537_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059536_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059535_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059534_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059533_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059532_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059531_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059530_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059529_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059527_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059526_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059524_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059523_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059522_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059521_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059520_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059519_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059518_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059517_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059516_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059514_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059513_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059511_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059510_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059509_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059508_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059505_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059504_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059503_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059502_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059501_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059500_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059497_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059493_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059492_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059491_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059489_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059488_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059486_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059472_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059468_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059465_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059464_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059463_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059462_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059458_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059457_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059456_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059454_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059453_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059450_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059449_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059448_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059447_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059446_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059444_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059443_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059442_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059435_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059434_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059432_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059431_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059429_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059428_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPPASPPVVPTDHG
MF059417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059412_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
LC603638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC461175_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC461174_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
LC349875_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349873_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881914_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881913_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881912_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881911_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881910_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881909_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881908_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881907_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881906_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881905_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881904_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881903_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881901_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881900_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881898_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881897_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881896_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881895_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881894_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881893_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881868_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881867_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881861_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881859_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881858_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881857_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881855_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881854_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881852_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881851_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881848_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881847_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881846_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881844_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881829_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881825_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY470962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470954_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KX429651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
KX429648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX429627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPTDHG
KX429621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPSAVPTDHG
KX429616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX276809_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KX276797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276778_HBx_P-B          MAARLCCQLDTTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276776_HBx_P-B          MAARLXCQLDXXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276772_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KX276770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KU964397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964252_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964136_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964135_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964134_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964133_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964132_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964131_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964130_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964129_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964128_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964127_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964126_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964124_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964123_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964122_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964119_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964118_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964116_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964114_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964113_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964109_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964108_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964092_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964091_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964090_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964089_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964088_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964087_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964086_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964083_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964082_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964081_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964080_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964079_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963988_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963987_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963986_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963985_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963984_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963983_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963982_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963981_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963980_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963979_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963978_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963976_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963975_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963973_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963972_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963969_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963968_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963967_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963966_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963965_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963964_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963963_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963961_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963960_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963855_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963818_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963806_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148580_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPPPGPLGALPPASPSAVPTDHG
KP148374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ173417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173412_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173408_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173388_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173387_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173378_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173362_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173361_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KC774417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774413_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC774410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774406_HBx_P-B          MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHG
KC774403_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHG
KC774401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774392_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KC774388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774387_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC774381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KC774380_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
KC774378_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KC774366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
KC774365_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163818_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163814_HBx_P-B          MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KC163812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX978431_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
JX661476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX661474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661472_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX504543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
JX429910_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX429901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ707767_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707765_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707763_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707761_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707760_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707754_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707751_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707750_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707749_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707748_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707747_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707744_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHG
JQ707743_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707742_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707741_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707739_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ688405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ429080_HBx_P-B          MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ341845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ341826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
JQ341812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHG
JQ341799_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AP011087_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
HM011490_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHG
KX276827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPXSPXAVPTDHG
AB642093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
JQ027334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
KX765854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
AB073823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KX276786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTXHG
JQ341850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHG
DQ993683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX276820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ040170_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KX276775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
JQ341811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHG
JQ341825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173279_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173280_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KU964098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964099_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964105_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964107_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964262_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964263_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964265_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964266_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964267_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964268_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964269_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964270_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964271_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY881952_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881953_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KY881957_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881958_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB976562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTYHG
AB104890_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB104891_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDG
AB713530_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713529_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713527_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB115551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB033555_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHG
AP011089_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHG
AB362933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB300370_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHG
AY206390_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
AY238972_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KR812005_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812006_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812008_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
KR812011_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812009_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MZ675802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279268_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279269_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279270_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279271_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279272_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279273_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP659220_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AY283777_HBx_P-B          MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ993680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MG571348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148458_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
GQ358136_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D23679_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHG
AB073848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
HM011496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349874_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429082_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ803784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349878_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHG
AP011086_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900097_HBx_P-B          MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX765841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
HM011492_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
GQ924639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
GQ924617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
FJ023635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
D50522_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50521_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB713531_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB493835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB246342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
AB073838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925384_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPASPSAVPTDHG
LC349872_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTNHG
JQ027316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHG
GQ924638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
EU660233_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660232_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660230_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900102_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB900111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AP011085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB367428_HBx_P-C          MAARVCCQLDPARDVLCLRPIGVESRGRPVSGPFGTLPSPSSPAVPADHG
KC814883_HBx_P-B          MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHG
MT757436_HBx_P-B          MAARLCCQLDPARDVLCFRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757438_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757443_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757444_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757445_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757446_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757449_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757452_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757454_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757455_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSVVPTDHG
MT757456_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757440_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757441_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757437_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757439_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757448_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757451_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757453_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757457_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757450_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757442_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757447_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
GQ924645_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHG
AB219426_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219429_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219427_HBx_P-B          MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHG
HM011474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHG
HM011477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHG
GQ377567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHG
GQ377525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ040169_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPIVPTDHG
JQ027315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHG
DQ995803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562259_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHG
AB675676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHG
MH488819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY417926_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPSNHG
KR232337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPTASPPVVPADHG
GQ358148_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
HM011484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AF121251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
GU815605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
D00331_HBx_C-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB900104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB287327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
KR152339_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
AB033554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
KP148459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
JQ341793_HBx_P-B          MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
JF436921_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ358150_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
GQ358149_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHG
KJ173297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
EF494381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815583_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHG
GU815584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815585_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815586_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815590_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815593_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815594_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815596_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815597_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815598_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815599_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815604_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815607_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815609_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815613_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MG571356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
KP148457_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPHGALPPASPSAVPTDHG
KC774405_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHG
JQ801524_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
JQ341819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
MK818225_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KY881869_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881835_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPLVPTDHG
KY881779_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881778_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881761_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881760_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881759_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881757_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881756_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881753_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881752_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881747_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881746_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881745_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881741_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881740_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881735_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881734_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881733_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881732_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881731_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881730_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881729_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881728_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881727_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881726_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881725_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881724_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881723_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881722_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881721_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KX276822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPPAVPTDHG
JQ341808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHG
MK534577_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK171374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK171280_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPLVPTDHG
MK075117_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
HM011473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHG
KC774367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596109_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
EU158263_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHG
GQ358138_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHG
GQ358151_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ358152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
AB214516_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK052965_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPPVVPTDYG
KC814873_HBx_P-B          MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHG
KY881784_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881800_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881795_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040147_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881781_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881782_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881783_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881786_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881787_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881788_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881789_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881790_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881791_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881793_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881794_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881796_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881797_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881798_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881799_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881801_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881808_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881850_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881785_HBx_P-B          MPARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
EU306700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
EU306708_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875427_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
GQ924632_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341818_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774396_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM392083_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875426_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KF192833_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
MG571341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPLVPTDHG
DQ448625_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
AY167093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNG
GU815574_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815577_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217357_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217358_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB195933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195934_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195935_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB073824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040128_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
DQ995802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
AY167098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY596105_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AP011095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
FJ386608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MZ439523_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439524_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439527_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439529_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439532_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439538_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439539_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439541_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439544_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439547_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439549_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439550_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439521_HBx_P-B          MAARLGCQLDTARDVLCLRPVGAESRGRPLPGPHGAVQPASPPAVPTDHG
MZ439518_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439517_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439519_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439520_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439522_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439525_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439526_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439528_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439530_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439531_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439533_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439534_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439535_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439536_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439537_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439540_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439542_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439543_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439545_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439546_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439548_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439551_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
GQ377641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
FJ562257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHG
FJ562289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHG
GQ377630_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPCVPTDHG
FJ386583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHG
AY220697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206383_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MK171542_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT622522_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPRVPTDHG
EU919175_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919176_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ899785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
EU939672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899786_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHG
GU815653_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
KY881780_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964115_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964117_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JF412801_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924653_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
FJ386610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDG
EU570069_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLG
EU570071_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLG
EU439021_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439018_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU350409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU305547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EF473974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
AY518556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN406371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU434372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
FJ386660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
DQ448624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
KX276796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
MK171525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPHVPTDHG
MK171427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTIHG
KM213035_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507210_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JQ341844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
JQ040138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHG
JQ341797_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHG
JF899335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815674_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
GU815668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815665_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815662_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815659_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815657_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815652_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815650_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815645_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
GU815642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815637_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815631_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815618_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815565_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815564_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815560_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815557_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815553_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815550_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815549_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU434373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924646_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
GQ924603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855522_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787444_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562237_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386669_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHG
FJ386582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU595031_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439023_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439022_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439020_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU305548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EF473975_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ975271_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHG
DQ448626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
D00330_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY766463_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
AY596111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AY310322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY293309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
AY167097_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF100308_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHG
AB471855_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB471854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB300364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB287329_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073837_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHG
AB073826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHG
AB073822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ904357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939671_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU939678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032349_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
FJ386675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562222_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU939669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
FJ562311_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AY206373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB073836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522073_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522075_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011482_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787476_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHG
FJ386615_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
AY167102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHG
AB900110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522074_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562260_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU919171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
FJ386680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KF192839_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192836_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KM524358_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
JN664912_HBx_P-D          MAARLCCQLDLARDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192830_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192831_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192832_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192834_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KU668441_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192835_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192837_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192838_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192840_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192841_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KU668440_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KM524338_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPPAVPTDHG
DQ991753_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
EU487256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
EU660224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
GQ377542_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
DQ993698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JX429902_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX026886_HBx_P-B          MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
KX276782_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
GQ377606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
GQ377566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHG
DQ993694_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHG
AY217362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF461360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027313_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011504_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
GQ377643_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899791_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ899790_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377537_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562296_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU919172_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU939639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939674_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ518812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ032358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AF100309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHG
AY217368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ032357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ562219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
AB031265_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
JQ272888_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
AB073825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
AF479684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHG
AB246339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AB287328_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121243_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
FJ023632_HBx_P-B          MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
FJ023631_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHG
MZ671237_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
MF674453_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
MZ675786_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
KJ803816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
AF121246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
GQ924605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
KC774364_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
KC774178_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
MG571365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTNHG
MG571344_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
MF674391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPFVPTDHG
HM011466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
JQ341815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
MK171468_HBx_P-B          MAARLCCQLDPARDVLCLRPVGXESRGRPLPGPLGAVPPASPPVVPTIHG
FJ904406_HBx_P-RF-DE      MAARMCCQLDPARDVLCLRPVGAESCGRPFSGPLGDISSPSLPAVPTDHG
FJ755833_HBx_P-B          GLSRLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924607_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ801514_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171365_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ562240_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173350_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173349_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939665_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377550_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171272_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377635_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803791_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU939676_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
GQ855689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
AB287323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287320_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHG
AB287321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
AB287325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KJ173401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
KJ173402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
HM011487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
AB073842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHG
KP659245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659234_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
JN792901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
JN792902_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
HQ700549_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
EU330994_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
DQ463791_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHG
AP011092_HBx_P-B          MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011088_HBx_P-B          MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB713528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
FJ349236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
AB287324_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGAPPPASPSAVPTDHG
AB287322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB219428_HBx_C-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
AB287326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011090_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011091_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473976_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
FJ023637_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358137_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358140_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358141_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP148452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148453_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148456_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPSSPSAVPTDHG
MK534696_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
LC349871_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPASPSAVQTDHG
DQ463798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
JN792899_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
AB287319_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659223_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287314_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287317_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EU330989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330990_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330992_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330995_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330996_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330997_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330999_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331000_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU331001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
KP659219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659235_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659237_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659221_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
KP659255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVXTDHG
KP659251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659252_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534724_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK534702_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK534576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPPASPSAVPTDHG
KP659246_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659250_HBx_P-B          MAARLCCQLDPARDFLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
EU579441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ463795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
DQ463793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463796_HBx_P-B          MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463790_HBx_P-B          MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792900_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463792_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463799_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
JN792894_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHG
DQ463800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792897_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792898_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MF674448_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLRALPPAPPSAVPTDHG
KU234318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHG
GQ855526_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHG
MF674492_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPAPPSAVSSDHG
MF674462_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPALPSAVPTDHG
AB031266_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
AB117759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPAPPSAVPTDHG
DQ993686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF925360_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674511_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674505_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674493_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674491_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPEPPSAVPTDHG
MF674455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674447_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674443_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MF674437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341840_HBx_P-B          MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674495_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB205122_HBx_P-B          MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB031267_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
AB212625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674432_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674500_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRSLPGPLGALPPAPPSAVPTDHG
MW310264_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT645018_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
MF674445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674434_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSAVPTDHG
MF674507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB212626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB073835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
JQ341848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW310261_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT426101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674513_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674510_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674466_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674451_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPAPPSPVPTDHG
MF674423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674401_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPLSAVPTDHG
MF674393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPAPPSAVPTDHG
MF674387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHG
DQ993682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB073854_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073857_HBx_P-B          MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534629_HBx_P-B          MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSPAVPADHG
KP148419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP148427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP659249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALPPXSPSAVPTDHG
MF674508_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPAPPSAVPANHG
KJ173373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
DQ463789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463797_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
GQ924635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
JN792895_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
JN792896_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
JN792893_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
HM011499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
KX276858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPXVPADHG
MG571340_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPIVPADHG
DQ993685_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHG
FJ023634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHG
AB073846_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHG
AB073851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KC774433_HBx_P-RF-DC      MAGRMGGQLDPARDVLCLRPVGGESRGRPFPGPFGFLRSPSSSAVPPDPG
KC774264_HBx_P-C          MDARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALRSPSSFAVPADHG
KC774292_HBx_P-C          MDARLCSQLDPARAILYLRPVGAESRGRPVSGQFGPLPSLFASAVPANHG
KC814919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESCGRPISGPFGTLPSPFSSAVPPDHG
MK512469_HBx_P-A          MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHG
AY161142_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161143_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161144_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY934763_HBx_P-A          MAARMYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDDG
MK512456_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KF922414_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922415_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922416_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922420_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922421_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922417_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922418_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922419_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
FN545825_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGSVSSPSPSAVPTDHG
FJ692603_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPAXHG
MH580627_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580639_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580642_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580643_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
AM184126_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
AM184125_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AM180624_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGXLPSPSPSAVPTDHG
FJ692555_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545837_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MW567976_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545833_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545830_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPISSPSPSAVSTDHG
FN545826_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692608_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692554_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
HM535205_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
GQ161788_HBx_P-RF-AE      MAARLCCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
GQ161837_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
HF571060_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ161767_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MT622525_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVSPDHG
LC462120_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545831_HBx_P-A          MAARLYCQLDSSRNVLCLRPVDAESRGRPLSGPLGALSSPSPSAVPTDHG
FJ692595_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692599_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AY934764_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692596_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545832_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FJ692611_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692606_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692601_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692605_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ161813_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545840_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545839_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FJ692612_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FN545834_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
KM606737_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545838_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545835_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545829_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545828_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVPTDHG
FJ692610_HBx_P-A          MAXRLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692613_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSASPSAVPTVHG
FJ692609_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692607_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FJ692604_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692602_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692597_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692600_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AB194951_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
AB194952_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
FJ692593_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692598_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
JN182321_HBx_P-A          TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KP168435_HBx_P-A          MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHG
AY934772_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHG
MK512461_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512468_HBx_P-A          MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHG
FM199974_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHG
FM199979_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199980_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199981_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563545_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512457_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512459_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512463_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512473_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512474_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512477_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHG
AB241115_HBx_P-A          MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692587_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSTSPSAVPSDHG
AF297623_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGSLGTLSSPSPSAVPSDHG
AF297624_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
KM519452_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KM519453_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
MK512475_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
KU736918_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736919_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB453988_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB246336_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHG
AB937791_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
AB937796_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
FJ692564_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692565_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692586_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692588_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692590_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692591_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922424_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KX276769_HBx_P-A          MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB116086_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHG
KP168425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168424_HBx_P-A          MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JX154582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
AY934765_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934766_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934770_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934773_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
DQ020003_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
MT426092_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
KU736920_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
JX154581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JN182318_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KJ854707_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHG
JN182333_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182332_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182331_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182330_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182328_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182325_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182324_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182322_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182323_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
MK512464_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHG
EF594769_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
KX357650_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
AY161147_HBx_P-RF-DA      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVQYDHG
KF214661_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594767_HBx_P-C          MSARLYCQLDSSRDVLCLRPVGAESRGRPLPRPLGTVSSPSPSAVPSDHG
KT151611_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHG
MT114170_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPPAVPSDHG
AB116084_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116083_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
AB453986_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214660_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHG
MN476101_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLARPLGSVSSPSPSAVPSDHG
JN574721_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876191_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876246_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594763_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905429_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905425_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KT366466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KF214666_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF214665_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315785_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116087_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116085_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB241114_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
AB246335_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AF090842_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151613_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHG
FJ876251_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876238_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876229_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876192_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594766_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAISSPSPSAVPSDHG
AB116092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHG
AY373429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373432_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214659_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
FJ876252_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876230_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876206_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876205_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876204_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876203_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876202_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876190_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594764_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
EF594758_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925372_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHG
M57663_HBx_P-A            IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KT235618_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876239_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594760_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
OK274310_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
MZ093431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
MF925361_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366470_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366469_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366468_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366467_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151618_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KT151615_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151616_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
AY161140_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AY161141_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AB453989_HBx_P-A          MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB116089_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151612_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151617_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
EF594768_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
FM199977_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
EF103278_HBx_P-A          MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLG
AY233278_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHG
AY161138_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161139_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KM243029_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KT151614_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHG
MT426088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KU605535_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF214656_HBx_P-RF-AC      MAARMYCQLDSSRDVLCIRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
GQ161753_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
MF115873_HBx_P-C          MAGGLCCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MF115871_HBx_P-C          MAARLCCQLDPARDVPCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MH464811_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357647_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHG
KU605534_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605533_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KP168422_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
KJ854699_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854687_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF922406_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922408_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922409_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF214662_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
KF214658_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214657_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214663_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875259_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875256_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875253_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875252_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875251_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
HM535200_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHG
FJ692570_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYG
FJ692563_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
DQ315786_HBx_P-A          MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
DQ020002_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
AY934771_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233281_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233279_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB246317_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB194950_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AY233288_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692573_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AB116090_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB937795_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KC875254_HBx_P-A          MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875258_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116082_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
DQ315784_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875255_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875257_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHG
MF925373_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
MF925385_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT347091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357644_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233290_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHG
MF925400_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHG
MK512466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MF925368_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KX357649_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHG
KU605536_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168434_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHG
KP168429_HBx_P-A          MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
FN545836_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AY934769_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHG
AY233275_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AF297625_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHG
KF922433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854685_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854686_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
MF772353_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854695_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
AB453987_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
EU366129_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
FJ692575_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KM606748_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464817_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KX357643_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT347092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHG
KP168430_HBx_P-A          MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
AB076678_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AM494718_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233274_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233276_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233282_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233283_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233284_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233287_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233289_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934767_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
AY934768_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934774_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
FJ692566_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHG
AB219430_HBx_P-B          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
MF772351_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KX648549_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
GU563547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FJ692592_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
KJ854691_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ854701_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
MN053840_HBx_P-A          --ARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
AB076679_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023660_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023661_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023662_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023663_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
MK512472_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AY233285_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY903452_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KF922434_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922435_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922436_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922437_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010776_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010777_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010778_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854690_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHG
KJ854694_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854697_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854700_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHG
KJ854702_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854704_HBx_P-A          MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854705_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854706_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168423_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHG
KF922429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
MK512471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHG
MK512470_HBx_P-A          MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHG
MH464810_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464809_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168432_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHG
KJ854688_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KJ854689_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854692_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
KJ854696_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854703_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692577_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692572_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHG
FJ692571_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692567_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692562_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNG
MK512476_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512465_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHG
MK512462_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512458_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHG
FM199976_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
AF043560_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692557_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692574_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692576_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692578_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692583_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692584_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692585_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
MT210034_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGXLSSPSPSAVPSDHG
AB116091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHG
AB116093_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AB116094_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692558_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692559_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692561_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FM199975_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MH464808_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHG
MH464812_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHG
AY233277_HBx_P-RF-AC      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426090_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MG877725_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MG877724_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MG877723_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU605539_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605538_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605537_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KT347088_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KX648547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KP168433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KJ586810_HBx_P-RF-AF      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT210032_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MN476102_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
MH464830_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464828_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464825_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464818_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464815_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464814_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464813_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
LC051141_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
KX648548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357646_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357645_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357642_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT347087_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHG
HM011485_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHG
KJ843183_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KP718085_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHG
KP718086_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AF326590_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
HQ700574_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
KJ598699_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
GQ855596_HBx_P-C          MAARLCCQLDPARDVLCLRPLRAESRGRPLSGPFGTLPSPSSSAVPTDHG
EU919197_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
AB674403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
AB674434_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KF471651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KR014043_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013923_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013942_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
JQ040130_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC163905_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
MN585097_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
FJ349296_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
AF143298_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KC163940_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
GQ477498_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP148483_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148465_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC164083_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164084_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306674_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306675_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924614_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164079_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164081_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164082_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164090_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164091_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164092_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164093_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164094_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164095_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164096_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164097_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148573_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC164080_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306694_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
KP148487_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR812088_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JF754625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGTESRGRSFSGSLGTFSSPSPSAVPTDHG
MG776525_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
KY470977_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPTDHG
KY470968_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470967_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPPPSSAAVPTDHG
KY470965_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470969_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470970_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470971_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470972_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470973_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470974_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470975_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470976_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470978_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470966_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB231909_HBx_P-B          MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MZ675798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MW601256_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097738_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSSPAVSADHG
KC875339_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875338_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
HM750150_HBx_P-RF-DC      MAARLCCQLDPARDVLCLCPVGAESRGRPFSGPPRSLPSPSSSAVPADHG
MZ097701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSXDHG
MF618349_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KC875342_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHG
KX196229_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875276_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196214_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
GQ205385_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205377_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205378_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205387_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
EF594775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
DQ486023_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPSAVSPNHG
AB674426_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGTLGTLSSPSPSAVSTDHG
FJ386640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPADHG
EF494376_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSTAVPADHG
KM606755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KM524339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAISSPPPSAVSTDHG
KC875340_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875312_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JF754629_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
JX507211_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPTDHG
HQ700571_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
KF214680_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSPAVPAVHG
JN664929_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
MN182675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MG776666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY363260_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN664940_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPPGSLSSSPPSAVPTDHG
FN594770_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPPLPAVPADHG
DQ315780_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
MZ097771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097762_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601300_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601289_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MN182663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
KC875295_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875288_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875287_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875283_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN664926_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN642151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
MW887651_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPTDHG
KX765849_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPPASAVPTDHG
GQ924642_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPISGPFGTLPSPASSAVPADHG
KM606750_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
JN257189_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
HQ700580_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
MZ097791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097697_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MZ097627_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MW601326_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601240_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSTDHG
MH724236_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MF925383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM577669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPPAVSTDHG
KJ470895_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KC774440_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESSGRPFSGPLGTLSSPSPPAVSTDHG
AB119254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119251_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ439385_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439382_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MH488850_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX276844_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPASSAVPADHG
KT991427_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KT991424_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HQ700492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HM750145_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSFAVPANHG
FJ904436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904401_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904396_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ562263_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
AB195951_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
AB195950_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
LT623847_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MZ097878_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDNG
MZ097817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
MT645017_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KX276849_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGXLPSSSSXAVPTDHG
KC774485_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
FJ023662_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
FR714503_HBx_P-G          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KU679943_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSPSAVPADHG
KJ470894_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSLPAVPADHG
KX276836_HBx_P-C          MAARLXCQLDPARDVLCLRPVGXESRGRPVSRPFGTLSSPSASAVPADHG
KU679951_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLXSPSPXAVPADHG
AY817511_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KC875299_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875300_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875307_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875308_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196208_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196211_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196226_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196227_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EF103281_HBx_P-D          MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257153_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPXPSAVSPNHG
JN257195_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSPNHG
MK693108_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSFPSPSAVSTDHG
DQ329356_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHG
DQ329357_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHG
EU560438_HBx_P-C          MAARVCYQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
GQ377623_HBx_P-C          MAARMCCQLDPARNVLCLRPVDAESRGRSVSGPFGALSSPSSSAVPADHG
KC774319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
FJ787490_HBx_P-C          IATRVCCQLDPARDVLCLRPVGAESRRQSVSGPFGPLPSPSSSAVPADHG
GQ377526_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSAAVPADHG
AB670259_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFEHLPSPSASALPADHG
AB367405_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSPAVPADHG
DQ089799_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871976_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU939564_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939569_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU939605_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386689_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
FJ787463_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MK171300_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSFSAVPADHG
MF059652_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPRPFGALSPPSSSAVPADHG
KR013998_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814905_HBx_P-C          MAARVCCQLDDAREVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814903_HBx_P-C          MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814927_HBx_P-C          MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814902_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSLTSSAVPADHG
JX560520_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU570072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU560439_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU522071_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSVSAVPANHG
AF461358_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSAAVPTDHG
AB670298_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
AB300372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB014388_HBx_P-C          MAARVRCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
AB367403_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
KC774279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSPAVPANHG
AB675677_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSPAVPADHG
KC774215_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC774216_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KJ598654_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHG
KJ598657_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHG
KJ598661_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASSAVPADHG
AB367421_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
AY220699_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939600_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ386665_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ475308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KR013827_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013865_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR014007_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814899_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814926_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
FJ562250_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSSAVPTDDG
FJ386628_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSAPAVPADHG
HQ622095_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGSLSSPSTAAVPADHG
JN418513_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
AB014389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
KR013844_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAIPADHG
AB014383_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
JN418510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
GQ475318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSAAVPTDHG
GQ377580_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSAAAVPADHG
S75184_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHG
MK171338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHG
AY247031_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSTAVPADHG
EU306713_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPADHG
MT645028_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
MK171584_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
KY363277_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSAAVPADHG
EU939616_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSXAVPADHG
GQ475343_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSAAVPADHG
AB367402_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB670300_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
D28880_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHG
AB367393_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGPESRGRPVSGSFGTLPSPSSSAVPADHG
EF103279_HBx_P-D          MAGRLCCQRDLARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KR812092_HBx_P-D          MAARLCRQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812093_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812105_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
MW601265_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097746_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AJ627220_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHG
MK598662_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHG
KM606744_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
MZ097695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHG
KP995112_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLPAVPTDHG
KM606752_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTVHG
KM606754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
JF440003_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440002_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440017_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN040828_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097789_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601308_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDDG
MZ097776_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDDG
MW601295_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097766_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVXTDHG
EU414141_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
MW601334_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
EU594382_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ692506_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ692507_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598651_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598657_HBx_P-D          MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601242_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097725_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097802_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSASAVPTDHG
EU594435_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103284_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU414142_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598655_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366504_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ111987_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AJ627217_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601305_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097805_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDYG
JN040804_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776396_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
JN040783_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040779_HBx_P-D          MAARLYCQLDPARDVLCLRPVVPESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN257160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN257161_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
JN642153_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN040809_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
AB222713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHG
MK618431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHG
JN257152_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSSDHG
KF849715_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
HQ236014_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN507852_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MT645019_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645008_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSPSAVSADHG
HQ236015_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724235_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB198080_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
AB367426_HBx_P-C          MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHG
AB367801_HBx_P-C          MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHG
KJ173335_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
KJ173336_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645021_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
GQ161765_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161769_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161779_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363591_HBx_P-E          MAARMCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ562298_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRTFGPLSSPSASAVPADHG
D23683_HBx_P-C            MAARMCCQLDPARDVLCLRPVGAESRGRPIPGSFGTLPSPSSSAVPADHG
KC774212_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
KC774211_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
JF828921_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSFGPLPSPSSSAVPADHG
AB670246_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AY066028_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPAHHG
JN040802_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSSSPSAVSTDHG
JN040806_HBx_P-D          MAARLRCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
HM363574_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
JX898687_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK618430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
KT963508_HBx_P-D          MAARMCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KC012652_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JN040807_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040805_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456650_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPASSAVSTDHG
GU456645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPTPSAVSTDHG
AB674413_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040800_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040801_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AJ131956_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AY796030_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754596_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JX470760_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JX898689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898691_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898694_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898697_HBx_P-D          MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KJ843187_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MG877709_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MG877710_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MK618429_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK618432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754603_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040813_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
MZ097675_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGTPGTLSSPSPSAVSTDHG
JN688678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDYG
FJ032340_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ032341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLSSPSSSAVPTDHG
EU939544_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPTDHG
EU554535_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSFAVPTDHG
DQ922651_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHG
EU554536_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU871970_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADRG
EU939565_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
GQ377534_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
MG776712_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MK171480_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPTDHG
MK171560_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPTDHG
KX765828_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KR014000_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173432_HBx_P-C          MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSSSAVPADHG
MK171524_HBx_P-C          MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSASAVPADHG
KJ173337_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC163950_HBx_P-C          MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
JQ707715_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707708_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171506_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475317_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGPLPSPSSSAVPADHG
GQ377636_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHG
GQ377579_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVAGPFGTLPSPSSSAVPADHG
FJ899778_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
FJ787456_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
EU939657_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
EU916234_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB014384_HBx_P-C          MAARVCCQLDPARDVLRLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
EU939571_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
GQ377572_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ377624_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939625_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
JN418542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
AB367424_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU306722_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562256_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
JN418521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418524_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418528_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418567_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC163949_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163961_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163965_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AB288026_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGNLPSPSASAVPADHG
AB367397_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB367434_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
FJ562293_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KJ173292_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173431_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341899_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPVGTLPSPSSSAVPTDHG
EU916229_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPLSGPFGPLPSPSSSAVPADHG
GQ924633_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939588_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
FJ386617_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLSSPSSSAVPADHG
MK171553_HBx_P-C          MAARVCCQLDPARDVLCLRPLGNESRGRPVSGPFGTLPSPSESAVPADHG
JQ707730_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707713_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707712_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707711_HBx_P-C          MAARMCCKLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707710_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707707_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475353_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787484_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787459_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562333_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562272_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562245_HBx_P-C          MAAGVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774245_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171645_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386627_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPXDHG
JQ707733_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707716_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707717_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707718_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707719_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707720_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707721_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707722_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707723_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707724_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707725_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707726_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707727_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707728_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707729_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707731_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707732_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
MT645050_HBx_P-C          MAARMCCQLDPTRDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645052_HBx_P-C          MAARMCCQLDPTRDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707714_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
KU964321_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964326_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ477479_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESSGRPLSGPLGTLSSPSPSAVPTDHG
MF925359_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AY251132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTNHG
KC814889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KC814920_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK171622_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAIPTDHG
FJ562265_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
EU916233_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089772_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171428_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939594_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
DQ980550_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB670253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ975273_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765855_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFRSLPSPSSSAVPTDHG
GQ855531_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSAVPTDHG
GQ855528_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSFAVPTDHG
FJ023643_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHG
FJ023644_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHG
KX765819_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPTDHG
KX765847_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPTDHG
MN844881_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSPSAVSPNHG
JN040784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
KR013870_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR013871_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014077_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014078_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014079_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR014082_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR014083_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KF849716_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849717_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPSPSAVPADHG
LT623850_HBx_P-E          MAARLCCQLDTARDVLCLRPVSAESRGRPVSGSLGDLSSPSPSAVPADHG
HM363565_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVPGSLGDLSSPSPSAVPADHG
MZ097700_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAFSANHG
MG877718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MG877719_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MG877720_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
JQ801476_HBx_P-RF-CG      MAARLCCQLDTSRDVLCLRPVSAESSGRPLSGPLGAFSPPSSSAVPADHG
MF772359_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
HM363611_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363599_HBx_P-E          MAARLCCQLDPARDVLRLRPVSGESWGRPVSGSLGDLSSPSPSAVPADHG
HM363596_HBx_P-E          MAARLGCQLDPGRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSGVPADHG
HM363575_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363578_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363598_HBx_P-E          MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161776_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161784_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161789_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161828_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962197_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161760_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161778_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161808_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161810_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MZ962189_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MZ962195_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
FJ349237_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
FJ349238_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
GQ161796_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580631_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580632_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580652_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
FJ349226_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDFSSPSPSAVPADHG
AY739674_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY739675_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
AY738144_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738145_HBx_C-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738146_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AB274984_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPPASAVPADHG
AB274978_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPTPSAVPADHG
AB274977_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPAPSAVPADHG
AB274969_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGDLSSPTPSAVPADHG
EU239217_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
LT623849_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
AB205189_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ097809_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDLG
MZ097645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601246_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSSDHG
MZ097729_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPXSGSLGDLSSPSPSAVSSDHG
MZ671249_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ671250_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439626_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439627_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439628_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439629_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPLSGSLGDLPSPSPSAVPADHG
MZ439631_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPLSGSLGDLPSPSPSAVPADHG
MZ439637_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPLSGSLGDLPSPSPSAVPADHG
MZ439639_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MK534638_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHG
JN827414_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALSSPSPSAVPADHG
JN827415_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHG
FJ023651_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
AF241410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ671248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ675791_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
GQ161785_HBx_P-E          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494712_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494714_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494832_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
KF170742_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MK720631_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MK720632_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AB241110_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241111_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AP011099_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AP011101_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGALGDLSSPSPSAVPADHG
EU410081_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
HQ700542_HBx_P-RF-CB      MAARLCCQLDPTRNVLCLRPVSAESRGRPVSRSLGDLPSPSSSAVPADHG
MT570164_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MK321264_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEXCGRPVSGSLGDLSSPSPSAVPADHG
KR811574_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363597_HBx_P-E          MGARMCCQLDPGRDVLCLRPVSAESWGRPVSGSLGDLSSPSPSAVPGDHG
GQ161781_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAIPADHG
EU239224_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGGLSSPSPSAVPADHG
AB274981_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPPVHG
AB219534_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPADHG
MK618437_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSSDHG
MK052972_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
EF103280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVSTDHG
FJ904412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AJ748098_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHG
KY629631_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGGLPSPSLSAVPADHG
AY862869_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
MG826135_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
MK534636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MK534640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645007_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPADHG
MZ439307_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439308_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439309_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439311_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439630_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ675793_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALSSPSPSAVPADHG
AB241109_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGALSSPSPSAVPADHG
MZ962198_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580645_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH464856_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPAVHG
MF772361_HBx_P-E          MAARLCCQLDLARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772360_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
KF170741_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
HM363600_HBx_P-E          MGARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDISSPSPSAVPAVHG
HM363566_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVTGSLGDLSSPSPSAVPAVYG
GQ161807_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594749_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAVHG
AB201287_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MZ097800_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSNHG
MZ097677_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSTSAVSADHG
MW601339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSPGTLSSPSPSAVSTDHG
MW601238_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK052956_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
JN688711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY233292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233294_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
HQ700511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
KP168418_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHG
KP168417_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHG
MF772357_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772356_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KF849727_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KU736899_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KF849719_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDYG
HQ700551_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363590_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363584_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
GQ161790_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161799_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161805_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161818_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161821_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239219_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060830_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
DQ060824_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADDG
DQ060822_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AB274985_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274979_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ097760_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGAFSSPSPSAVPTDHG
MZ097668_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHG
MW601286_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGAFSSPSPSAVPTDHG
MG776411_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHG
MG776410_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHG
AP011100_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHG
EU410080_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHG
KJ470897_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
AY233293_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
GQ161820_HBx_P-E          MAARLCCQLDPARDVLCLRPVXAESCGRXVSGSLGDLSSPSPSAVPADHG
GQ161814_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161812_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPPDHG
GQ161792_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161782_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
MH724245_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
MH464841_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPXDHG
MH464840_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
MT570163_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
MT570162_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGTLSSPSPSAVPADHG
MZ962199_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962196_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962194_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962193_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962192_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MZ962191_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962190_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW679683_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
MW679682_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MW455165_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MW455164_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455163_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455162_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
MW455161_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507847_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MN507845_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507844_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507841_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
MH918655_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSTVPADHG
MH580649_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580647_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580646_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580638_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580637_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580636_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580635_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580634_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580629_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580625_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580624_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580622_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580621_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MF772362_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
LT623848_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623846_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
LT623843_HBx_P-E          MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPAVHG
KX186584_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736898_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736897_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736896_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736895_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736894_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGGLSSPSPSAVPADHG
KF849726_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849724_HBx_P-E          MAARLYCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849723_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849722_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849721_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849714_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849713_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ000009_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ000008_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700552_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363588_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363577_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363568_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVLGSLGDLPSPSPSAVPADHG
GQ161836_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
GQ161835_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161833_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161832_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161830_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161829_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161826_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161825_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSPGDLSSPSPSAVPADHG
GQ161824_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161822_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161819_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161817_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSTVPADHG
GQ161816_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161804_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161803_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161802_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161801_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161800_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161798_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161797_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161795_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161794_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161793_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161791_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161787_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161786_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161783_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161780_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161777_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161774_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161773_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161772_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161771_HBx_P-E          MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGALSSPSPSAVPADHG
GQ161770_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161766_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161764_HBx_P-E          MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161763_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161762_HBx_P-E          MAARLCCQLDPARDVLCLRPVRAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161761_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161759_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161758_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161756_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161755_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594763_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594756_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594748_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPXDHG
FN545821_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239226_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
EU239221_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
DQ060829_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060828_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060826_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060825_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
AM494700_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494696_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494694_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AB915175_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AB274976_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274974_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274972_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274971_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274970_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205192_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205191_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
AB205190_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205129_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB201289_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
AB201288_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB194947_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB091256_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
MZ097722_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSSGHG
MW601321_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGTPGTLSSPSPSAVSTDHG
MW601311_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601237_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSSGHG
MK541688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK052974_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPNHG
MK052966_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052963_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052958_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052955_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052953_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052950_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052947_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
KJ647351_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
MT426115_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623845_HBx_P-E          MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363608_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363603_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
HM363594_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
HM363592_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363589_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363587_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363586_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
HM363581_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363580_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363579_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363576_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594762_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205188_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB194948_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
KJ647353_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRSLGTLSSPSPSAVPXDHG
JN688683_HBx_P-D          MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXLGTLSSPSPSAVPXDHG
JN688715_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXXGTLSSPSPSAVPXDHG
KU964318_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964322_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964324_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR811950_HBx_P-C          MAAGLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ922001_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922002_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
AB674412_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
X85254_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTFSSPSPSAVPTDHG
MZ097689_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGSLGTLSSPSSIAVSTDHG
MZ097676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776524_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AB112066_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MZ097828_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097831_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
AB109478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB090270_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN839643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MW601332_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
KR905422_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366503_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MW601268_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTPSSSSPSAVSSDHG
AB119256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTPSSPSPSAVSSDHG
AB090268_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119255_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423702_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MH932714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK598664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066394_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
MN182693_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MW601333_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MN066398_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN688689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVPTDHG
MG776777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776576_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KX423707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423722_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KC875315_HBx_P-D          MAARLCCQLDPARDVLCLRPGGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JQ032006_HBx_P-D          MAARLCCHGVPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ922000_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464169_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KR811522_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPTDHG
KR811524_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR811636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR811637_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MN066387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ377592_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPSVVPTDHG
HM363593_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPTDHG
MZ097713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGTLSSPSPSAVSTDHG
MZ097661_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601331_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776473_HBx_P-D          MVVRLCCQQDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
KF471660_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KC875279_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
JN642128_HBx_P-D          MAARLCCQLDPARDVLCLRPVGDESRGRPFSGPLGTLSSPSPSAVSPNHG
JN040811_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040795_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
DQ464175_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPRNHG
AB270542_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSSDHG
MT645014_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
JF754606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSTSAVSTNHG
JF754622_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257176_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257177_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776378_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776398_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776390_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464164_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464165_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464166_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464167_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
MG776797_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239220_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW601277_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
MW601274_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MZ097750_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601267_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MT591278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MH724220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MG776796_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776766_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776747_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776748_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776742_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776682_HBx_P-D          MAARMSCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776604_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776585_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776779_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776567_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776569_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776597_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776516_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776523_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MF925366_HBx_P-D          MAARLCRRLEAARDVLCLRPVGAESRGRPLPGPLGALPSPSPSAVPTDHG
KX423706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM524356_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
KF471647_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSTDHG
KF471642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196210_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196213_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSSSPSAVSTDHG
GQ205384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
DQ315779_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
FJ904410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
HQ700458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
FJ904395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KJ470889_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
AY796032_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY236160_HBx_P-D          MAARPCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AJ344116_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGTISSPSPSAVSTDHG
AB674429_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT364721_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KC774236_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
JQ801490_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
JQ801515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ410515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
JN574724_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ598727_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
KJ598736_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KJ598737_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KU964235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
FJ023645_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPISGPFGTLPSPSASAVPTDHG
EF594753_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MN689120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
MN689121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPPGALPPASLSAVPTDHG
GU456671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MZ097884_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDXSSPSLPAVPTDHG
FJ904440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
JN040777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721609_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
KP090179_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTAHG
MZ097696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
KJ586811_HBx_P-RF-DF      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC774450_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFQGPLGTLSSPSPSAVPTDHG
JN040798_HBx_P-RF-DE      MAARLCCQLDSARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
FN594769_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGDESCGRPFSGPLGDLPSPSLPAVPTDHG
FJ904442_HBx_P-RF-DE      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904428_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPIGAESCGRPVSGPLGDLSSSSLPAVPADHG
AY373430_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KR811571_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDHG
KM606739_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
FJ349240_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
S77748_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MZ097679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MN066395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK693107_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776731_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776644_HBx_P-D          MAARLCCQPDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MG776539_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776535_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776416_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776397_HBx_P-D          MAARLCCQLGPARDVLCLRPVSAESRGRPFSGPLGTLPSPAASAVPPNHG
MF618341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KX827300_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
KT749845_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT366508_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPSPSAVSTDHG
KR812075_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KM519455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KJ647355_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875314_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875286_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ707687_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN642133_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
MG776639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JF754632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
JF754630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
HQ700454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ236016_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAIPTDHG
HM750153_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456668_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPTPSAVSSDHG
GU456637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLASPSPSAVSTDHG
GQ477455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
FJ876257_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ692533_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRTLSSSSLPAVPTDHG
FJ562338_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGSLGTLSSPSPSAVPTDHG
EU594434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF594771_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
DQ464168_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ336682_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
AY721605_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY090452_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AJ627224_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AJ627223_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGSLGTLSSPPPSAVSTDHG
AB674417_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB188244_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW887643_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU051424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051426_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KR811644_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
HQ700516_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDLSSPSSSAVPTDHG
DQ089778_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB205125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
DQ089803_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ315781_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ315782_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ315783_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
EF594749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EF594754_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EU717214_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU872005_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939609_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
FJ023652_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSASAVPTDHG
GQ924612_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
JN827423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MF488702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
GQ205386_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
FJ349221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
LT623851_HBx_P-E          MAARLCCQLDPARDVLCLRPVXTESCGRPVPGSLGDLSSPSPSAVPAXHG
MZ097882_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSAPSPSAVPTDHG
MZ097867_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSSDHG
MZ097836_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGPFGTLSSPSPSAVSTBHG
MZ097812_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPPSSPSPSAVSTDHG
MZ097810_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPAPSAVSTDHG
MN066403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH464838_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464836_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776749_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPYPSAVSTDHG
MG776668_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVPTDHG
MG776582_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSACAVPPNHG
MG776543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KX423711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KM524349_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC875284_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN688710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN642135_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642132_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040819_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
JN040810_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040808_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTISSPSPSAVSTDHG
JN040767_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
JN040762_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGPFSSPSPSAVSTDHG
JN040751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754619_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754614_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JF754592_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
HQ700481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HM750156_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTATVSTDHG
GU456678_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSTPSPSAVSTDHG
GU456672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
GU456670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
GU456669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSASPSAISTDHG
GU456642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSTVSTDHG
GU456636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
GQ183463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
FJ904445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ349206_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPPAVSSDHG
AJ627215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSVHG
AB674425_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ439451_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGPLPSPSSSAVPTDHG
MT645003_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPTSSAVSTDHG
MF674418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KY670782_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGGLPSPSLSAVPTDHG
JN040786_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JN040787_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754607_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN688679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN066383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KR812102_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812100_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812099_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812097_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812091_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN688717_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
JN664915_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPFSGSLGSLSSSHPSAVPTDHG
AY800249_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATLG
AB194949_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPFGTLSSPSPSAVPTDHG
MG776745_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776734_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776427_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594759_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSXSPSAVPPDHG
FN594751_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTNHG
DQ060823_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
MZ097863_HBx_P-D          MAARLCCQLDPARDVLCLRPVGVESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097851_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097819_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097749_HBx_P-D          MXGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097699_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRSFSGPLGALSSPSPSAVSTDHG
MZ097653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTXSSPSPSAVSTDHG
MW601318_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601234_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN585094_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTPSSPSPSAVSTDHG
MN507836_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724225_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724219_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MH724218_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MG776759_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776623_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MG776544_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776538_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776537_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776513_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776493_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776490_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776461_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776454_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776453_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776450_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776444_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KX357638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
KU668436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090178_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090177_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM577668_HBx_P-D          MAARLCCQLDTARDVLCLRPVSAESRGRPVSGPLGTLASPSPSAVSTDHG
KF471658_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF170739_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875294_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875293_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875289_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875281_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875275_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642148_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALTSPSPSAVSTDHG
JN642144_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257188_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN257187_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN040752_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
HQ700514_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
FJ904427_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPTDHG
DQ464178_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSTSPSAVPTDHG
DQ464174_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB674409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270548_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSLSAVSTDHG
AB270537_HBx_P-D          MAARLCCQLDPAWDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB104712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ675787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSASAVPTDHG
MZ671245_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSASAVPTDHG
MG571335_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF925403_HBx_P-C          MAARLFCQLDSARDVLCLRPVGAESCGRPLSGPIGDLPSSSSSAVPTVHG
MF674442_HBx_P-C          MAARLCCQLDPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU051423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPTDHG
KT987426_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KF214668_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLQGPLGTLPSPSPSAVPTDHG
KC774218_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
JQ801493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPTASAVPTDHG
GQ358154_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAIPTDHG
DQ089804_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSASAVPTDHG
AF068756_HBx_P-C          MAARLCCQLDPARDVLCLRPFGAESRGRPISGPFGALPSPSSSAVPTDHG
MF925362_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHG
KR811561_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GQ161775_HBx_P-E          MAARLXCQLDXSRDVLCLRPVGAESRGRPLSGXLGTLSSPSPSAVPTDHG
MZ097870_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097855_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097801_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642165_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KJ803827_HBx_P-RF-BC      MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPSPSSSAVPTDHG
KJ803753_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSSSSSAVPTDHG
JN257210_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
EU594406_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY040627_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPTAHG
AB674432_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776729_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSPSAVSTDHG
MZ097875_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPVGTLSSPSPSAVSTDHG
MZ097853_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097852_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097842_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MZ097816_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097783_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTBHG
MZ097715_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVSTNHG
MZ097698_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097693_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097660_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097629_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601330_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MW601299_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MK598678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH724246_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776703_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776661_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776629_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776626_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776541_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776533_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776510_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776505_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776488_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776438_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALASPSPSAVSTDHG
KX357637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736926_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KJ647350_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KF471650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018211_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018197_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642162_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642140_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257178_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
FJ904398_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLSAVPTDHG
JN257172_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257173_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MZ097779_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPSAVSTDHG
GQ161806_HBx_P-RF-EA      MAARLXCQLDXSRDVLCLRPVSAESXGRPLSGSLGDLSSPSPSAVPTDHG
KM577667_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM577666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPTDHG
KM577665_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577664_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577663_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM524359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KM524337_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
KM524336_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN664933_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
GU563560_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ183486_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103285_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
DQ315777_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
AY233295_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
OM256457_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
MH464844_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MF772354_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
JN688722_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVSTDHG
JF754631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
MH464834_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU155893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU414143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366505_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
KT366492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KM606751_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM606741_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM359442_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
KJ470898_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470891_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
KF170740_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPPGDLSSPSLPAVPTDHG
JN664934_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664925_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GU177079_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
FN594771_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLSAVPTDHG
FJ904441_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904416_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904409_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
FJ904400_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ692536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AM494716_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTNHG
AB270538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLASPSPSAVPPDHG
AB188245_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLSAVPTDHG
AB048703_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB048702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
JQ272902_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349239_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
AB274982_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
Y07587_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESHGRPFSGSLGALSSPSPSTVSTDHG
V01460_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
S41175_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSTVSTDHG
OK106256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
MZ097879_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097874_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097871_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097869_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPXGSLSSSPPSAVPTDHG
MZ097868_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097845_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097840_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097834_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRTLSSPSPSAVSTDHG
MZ097824_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097818_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MZ097804_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGTLSSPSPSAVPTDHG
MZ097793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097781_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MZ097778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLSSPSPSAVSTDHG
MZ097772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097747_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MZ097743_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRPLSSPSPSAVSTDHG
MZ097718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MZ097717_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSPDHG
MZ097709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTNHG
MZ097686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097673_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
MZ097671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097626_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MW601327_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601324_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MW601312_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601309_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601307_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLSSPSPSAVSTDHG
MW601280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601275_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVPTDHG
MW601266_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTYHG
MW601229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSPDHG
MT591279_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT579899_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN507839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN507837_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MN476100_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPPLSAVPTDHG
MN310714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN182682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066385_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK618433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSTVSTDHG
MK618427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MK598674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
MK598669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPFGTLSSPSPSAVSTDHG
MK598658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
MK598644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MK598640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK507914_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK507912_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MK507911_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
MK507910_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK052975_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052973_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052971_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052959_HBx_P-D          MAARLCCQLDPARDVPCLRPVSAESGGRPVSGPPGTLSSPSPSAVPPDHG
MK052949_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MH724251_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MH724250_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724249_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724248_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724247_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724238_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPFPSAVSTDHG
MH724233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MH724230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724227_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724226_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724224_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724221_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776783_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MG776756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776732_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MG776718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRTLGTLSSPSPSAVSTDHG
MG776701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776624_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRRRPFSGPLGSLSSPSPSAVSTDHG
MG776616_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSVVSTRHG
MG776599_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776598_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776596_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776592_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776591_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776589_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776588_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776583_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776579_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776571_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776568_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776561_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776560_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776559_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776558_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776554_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776546_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MG776522_HBx_P-D          MAARLCCQLDPARDVXCLRPVGAESRGRPFSGPLGTFSSPSPSXVSTDHG
MG776509_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776495_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776464_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776448_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVSTDHG
MG776415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776394_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776393_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MF925363_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MF618342_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
MF618339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF488704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
LT992454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPPDHG
LC365689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KX423713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KX357639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTHSSPSPSAVSTDHG
KX196234_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196222_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196221_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196212_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196209_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736925_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736924_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU668448_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668447_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT366507_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT366502_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSHSTSALSTDHG
KT366498_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366497_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT347090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT235632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT235630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT235624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
KT235615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSTDHG
KP317981_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP090181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KP090180_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM606745_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGSLGTLSSPSPSAVPTDHG
KM524345_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM524340_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF922432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSSSLPAVPTDHG
KF679993_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679992_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679990_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSFGTLTSPSPSAVPTDHG
KF679989_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF471646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471645_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSTSAVSTDHG
KF061169_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061168_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061167_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KC875337_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875336_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875335_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875334_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875326_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875321_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875319_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875317_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
KC875313_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875306_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875304_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875302_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875285_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875282_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFQGPAGTLSSPSPSAVPTDHG
KC774444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPPAVSTDHG
KC774437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JX096957_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX096954_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JQ707706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707703_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707702_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707700_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707699_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707698_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707697_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707694_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707693_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707691_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN688695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN664938_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664937_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664930_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664928_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664922_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664921_HBx_P-D          MAARLCCQLDPARDILCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664920_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664917_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664914_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664911_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664910_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
JN664909_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN642163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN642155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642146_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTNHG
JN642138_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPLGTLTSPSPSAVSTDHG
JN642131_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642130_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642126_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN574725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JN257205_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257185_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257182_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
JN257181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN257167_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGSLSSPXTSAVSTDHG
JN040794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTISSSSPSAVSTDHG
JN040790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JN040788_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040776_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040766_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
JN040753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSHSAVSTDHG
JF911690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
JF911683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JF754612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754602_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSTDHG
HQ833471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSPISTDHG
HQ700513_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700512_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSTSAVSTDHG
HQ700480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPLGTLSSPSTSAVSTDHG
HQ700470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HM750151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPTDHG
GU456679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSPSAVSTDHG
GU456676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVSTDHG
GU456662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDYG
GU456655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ477457_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ205389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205388_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
GQ205380_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ183484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
GQ183478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ183470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
FJ904443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904433_HBx_C-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGGLSSPSLPAVPTDHG
FJ904432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVSTDHG
FJ904429_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904399_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
FJ876254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ876242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ692532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
FJ349232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ349228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349213_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSTGTLSSPSPSAVPTDHG
FJ349209_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU939680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU787446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU594397_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414140_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTNHG
EF594774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ486022_HBx_P-D          MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ486021_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464173_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464172_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464170_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ336690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336684_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336683_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336680_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ315778_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
DQ315776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY741797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
AY741796_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741795_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY721612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721610_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721607_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY373431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY236164_HBx_P-D          MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY233296_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY233291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
AY161160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161157_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161156_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161153_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161152_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY090453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AM422939_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AJ627219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AJ627218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AJ627216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AF280817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB674422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLRSLSSPSPSAVSTDHG
AB674407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB246347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
AB222711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
AB126581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB109479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB104709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB048701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
MZ671251_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MZ671235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
MK534671_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSPAVPTDHG
MK534642_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
MF674484_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765843_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLSSPSSSAVPTDHG
KX765840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765838_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGALPSPSASAVPPNHG
KX765837_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSASAVPPVHG
MN066399_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
AB330368_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097881_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPXPSAVSTDHG
MZ097825_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097773_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097733_HBx_P-D          MAARLCCQLDPARDVLCXRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601336_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MW601335_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601322_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601319_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
MW601313_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601291_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MW601279_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MW601269_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601249_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601248_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW455166_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT591277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MT591276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MN310707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN310706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN066388_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MK355501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MH724241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724223_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776789_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776763_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776760_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776720_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776717_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776671_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776670_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MG776655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MG776652_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776587_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776586_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776566_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776555_HBx_P-D          MAARLCCQLDPARDVVCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776553_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776528_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776506_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776498_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVPTDHG
MG776470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776449_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776417_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776400_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776399_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776391_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTNHG
M32138_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX260231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KP317983_HBx_P-D          MAARLCCQLNPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KM524348_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KJ470896_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KF471654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642166_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642156_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
JN642149_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642147_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSTDHG
JN642145_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642142_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257202_HBx_P-D          MAARLCCQLDPARDVLCXRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257201_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257200_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN257183_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257170_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257149_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPLGTLSSPSPSAVSTDHG
JN257148_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040829_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040824_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040773_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040760_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPSAVSTDHG
JN040755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754634_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSXSAVSTDHG
JF754627_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF754626_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754617_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754609_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754598_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754591_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
HQ833467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700489_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
GU456683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456675_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456673_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
GU456665_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSSSPSAVSTDHG
GU456638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
FJ349233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349220_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349217_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
EU787439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787438_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EF103276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464182_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF151735_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121239_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AF043594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AF043593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AB674416_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674414_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB674411_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270550_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLSSPSPSAVSTDHG
AB270549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB222710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGTLSSPSPSAVSTDHG
AB210820_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
AB188242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MZ671241_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
MZ439516_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439512_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439511_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439510_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439509_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439508_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439507_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439506_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439505_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439503_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439500_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439499_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439498_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439497_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439494_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439492_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439490_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439487_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLTSPSSSDVPTDHG
MZ439485_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439484_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439483_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439482_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439479_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439478_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439477_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439476_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439474_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439471_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439469_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439467_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439466_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439465_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439464_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439462_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439461_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439460_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439458_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439457_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439456_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439455_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439454_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439453_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439452_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439450_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439449_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439448_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439447_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439446_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439445_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439444_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439443_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439442_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439441_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439440_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439439_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439438_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439437_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439436_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439434_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439433_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439432_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439431_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439430_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439429_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439427_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439426_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439422_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439421_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439420_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439419_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439416_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439415_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439414_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439413_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439412_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439411_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439409_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439407_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MW887652_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MT645004_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
MT645000_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MT644995_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
MT114171_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
MK534678_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
MH220971_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPTDHG
MG826122_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MG725248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925394_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPTDHG
MF925365_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF674504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674467_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674444_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
MF674390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674388_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765842_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765822_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
MN310708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JQ027310_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPXGTLPSPSSSAVPTDHG
JN642137_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257216_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257191_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257174_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JF754613_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
FN594760_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594753_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
MZ097877_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097860_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
MZ097833_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097807_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097763_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097753_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MZ097732_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097730_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPXSGPLGTLSSPSPSAVSTDHG
MK052954_HBx_P-D          VAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MG776610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776574_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904446_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KJ803785_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801477_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN642139_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642127_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257207_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257206_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257204_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257164_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257154_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVSTDHG
JF754616_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGPLSSPSPSAVSTDHG
AB674433_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB033558_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHG
Z35716_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
X80926_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
X80924_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
MZ097883_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097876_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097856_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097849_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097848_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097837_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097835_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097832_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097823_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097815_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097813_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097788_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097787_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097786_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097764_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097759_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097736_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097734_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097728_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSPSPSAVSTDHG
MZ097712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
MZ097702_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097665_HBx_P-D          MAARLCCQLDPXRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSXSPSAVSTDHG
MZ097662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
MZ097648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
MZ097631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPPGTLSSPSPSAVSTDHG
MZ097630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601303_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601302_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601298_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MW601285_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601283_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601282_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601250_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601245_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSPSPSAVSTDHG
MT579903_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579902_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579901_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579900_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579898_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT114169_HBx_P-D          MAARLCCQLDPARDVVCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MN891828_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN844882_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN507853_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN310705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK693109_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598673_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
MK598672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598668_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MK598649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
MK598642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGLPFSGPLGDLSSPSPSAVSTDHG
MK598636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK507913_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK355500_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK052961_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052952_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MH724231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724217_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MG776788_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776762_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776752_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776743_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776739_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776738_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
MG776735_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776730_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776727_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776723_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTIHG
MG776683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776681_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776650_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSTDHG
MG776548_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776547_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776536_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776518_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776507_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776492_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776486_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSASAVSTDHG
MG776482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776436_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
MG776423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF618343_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KY629630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLSAVSTDHG
KY382414_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY382412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX827301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KX827291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX827290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSTVSTDHG
KX423692_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736927_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KP322601_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP317982_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KM577670_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPSAVSTDHG
KM524342_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KJ647352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSSSPSAVSTDHG
KF584166_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584165_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584164_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584162_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584161_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
KF061170_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KC774462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTLSSPSPSAVPTDHG
JX096958_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096956_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096955_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
JN642164_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642161_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
JN642159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
JN642136_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
JN642129_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257199_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257196_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257190_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLTSPSPSAVSTDHG
JN257171_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257169_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN040830_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JN040826_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSTVHG
JN040793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040780_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040769_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040759_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN040758_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF911682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSTDHG
JF754635_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JF754618_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754605_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JF754601_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833465_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700553_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700488_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLSSPSTSAVSTDHG
HQ700478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700464_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700451_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700450_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700449_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700448_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700447_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ700440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HM750155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
GU456664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456661_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456660_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ477459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
GQ477456_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ899792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349234_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349230_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349218_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU939681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787447_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
EU787445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
EU787436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594425_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594416_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594411_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594400_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594399_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594398_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594396_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
EU414138_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414136_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ111986_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY945307_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY661793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AY661792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121240_HBx_C-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB583680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB330370_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB330369_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB246348_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
AB222712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB222709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205127_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ675789_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MZ671247_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
MZ439685_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSSSTVPTDHG
MT111596_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
MK534667_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
MK534666_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534647_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534645_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
MK534643_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534631_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534624_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534619_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
MF925410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925408_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925406_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925377_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGALPSPSSSAVPTDHG
MF925375_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674474_HBx_P-C          MAARLCCQLDPARDVVCLRPVSAESSGRPISGPFGPLPSPSSSAVPTDHG
MF674412_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MF674402_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF488703_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
LC592172_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
LC592171_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765851_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAKSRGRPLSRPFGTLPSPSSSTVPTDHG
KX765850_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765848_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765834_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGTLPSPSSSAVPTDHG
KX765833_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765832_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KX765831_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSASAVPTDHG
KX765825_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
KX765821_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KX765818_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX276850_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESSGRPXSGPFGALPSPSSSAVPTDHG
MZ097692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097803_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALASPSPSAVPTDHG
MZ097769_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX276847_HBx_P-C          MAARLCCQLDPARDXLCLRPVGAESRGRPXSGPFGXLPSPSSSAVPTDHG
MZ097705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875296_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875297_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875298_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875303_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875305_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875309_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322599_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196236_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776504_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776514_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776563_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776602_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776603_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776614_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776572_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776584_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776607_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776620_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776622_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776764_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776767_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
KR812103_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812104_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812106_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KC774191_HBx_P-C          MDDRVCCQLDPARDVLCLRPVGVESRGRPVSGPFGAFPSPSSFAVPADHG
JN664924_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
HQ700495_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700496_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
AY161146_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAIPSDHG
MG776628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KR013839_HBx_P-C          MAVRLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KC163906_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
EU306672_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
HQ700498_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
HQ700499_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
AB493844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AB493842_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
KJ173299_HBx_P-RF-CB      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
KJ173300_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
AY161145_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPADHG
MK171535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSASAVPADHG
KR014021_HBx_P-C          MTARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR811654_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSFGALPSPSSSAVPTDHG
AB112348_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
JN257209_HBx_P-D          MAARMCCQLDTARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
JF754604_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTFSSSSPSAVSTDHG
MZ097796_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097858_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
KR013836_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013837_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013838_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013840_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013841_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013835_HBx_P-C          TAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KJ586803_HBx_P-RF-AF      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ097841_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JQ032007_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KC774459_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JN257193_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN257194_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MN585095_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTNHG
KY363280_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KJ803818_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803799_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPFGTLPSPSSSAVPTDHG
KC774235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGALPSPSLSAVPADNG
HQ700556_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSFAVPANHG
GQ924609_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803794_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ349225_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
FJ023642_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDYG
EU570068_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
DQ089765_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
AB112408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
AB074756_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
AB247916_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
AB031262_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSPSAVPTDHG
AP011097_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPTDHG
KC875260_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHG
AF297621_HBx_P-A          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU554537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554538_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU554539_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163958_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163959_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KJ803779_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470980_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470981_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470982_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470984_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470988_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KP148472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997829_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997830_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997831_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB105173_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF223957_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EF594748_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSPSAVPTDHG
FJ023639_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
FJ023649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023657_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ358153_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ855525_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
GQ855534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924613_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
GQ924629_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ924636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GU563561_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPTDHG
JN104437_HBx_P-C          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827416_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JN827417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JN827418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JN827420_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827421_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827422_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPTDHG
JQ801473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JQ801486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
JQ801508_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801510_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSPSAVPTDHG
JQ801511_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ801513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSTSAVPTDHG
JQ801519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JX507214_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803812_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
KP148549_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT235617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVSTDHG
KT307718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT307719_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT364718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPVGTLPSPSASAVPTDHG
KT364719_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT364720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT366463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KT987423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
KT987424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT987425_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
KU051425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTAHG
KU051427_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
AF223958_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ855533_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645023_HBx_P-C          MAARLCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MK171537_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHG
KR013895_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013764_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KJ997846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFETLPSPSPSAVPTDHG
KJ803761_HBx_P-C          MAARLCCQLDPARDVLWLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ598639_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KC163957_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
JQ341883_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418554_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
JN418534_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
HM011495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
GQ924604_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GQ377552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939539_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
EU916218_HBx_P-C          MAARVCCQLDPARDVLCLRPISAESRGRPVSGPFGALSSPSSSAVPADHG
EU547562_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPPSSAVPADHG
EU547559_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEXSGRPVSGPFGNLPSPSXSAVPADHG
EU305540_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ980549_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY308741_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ788835_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871973_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871974_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU939614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386645_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828916_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828919_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418546_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPANHG
JN418556_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
KJ173319_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964014_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964216_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964221_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MK171289_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171326_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171329_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAXHG
MK171360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171370_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF473543_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670274_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB115417_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSRPFGPLSSPSWSAVPADHG
MN689122_HBx_P-B          MAARLCCQLDPARDVLCLRPVEAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534611_HBx_P-B          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
MT426093_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTFSSPSPSAVPADHG
LT992441_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHG
KP148532_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC814906_HBx_P-C          LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
GQ475350_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSTAVPADHG
GQ377536_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU859901_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ089787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
AB697487_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ803822_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
GQ358156_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
DQ089798_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AP011105_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ097830_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT426107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK534656_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534644_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK534628_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534622_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534605_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPADHG
MK171389_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPSGGLPSPSSSAVPADHG
MG826136_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MG826134_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826133_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826127_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
MG571345_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
MF674472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674454_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674386_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279275_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279249_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279247_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279246_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
KY629637_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470991_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470990_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470987_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470986_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470985_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470983_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470936_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KX765845_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KX765830_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KX765827_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPISGPFGTLPSPSSSAVPADHG
KX765824_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX765823_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KX429658_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KU964184_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964179_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU963914_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963913_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963912_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963911_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963910_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963909_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963908_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963907_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963906_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963905_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963904_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963902_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963901_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963900_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963884_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963875_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963871_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811763_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811762_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811760_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811756_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811750_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811748_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811746_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013927_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013904_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013857_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013768_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013767_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013762_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KP148574_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KP148571_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148570_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148568_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148566_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148564_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148562_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148561_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148558_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148557_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148555_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148552_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148547_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148546_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148540_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148535_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148531_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148529_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148525_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148524_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148521_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148517_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148482_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148479_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148477_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148476_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148474_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148471_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148469_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148464_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148462_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148315_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM359441_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ997841_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997816_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997815_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997811_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ803814_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803813_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803811_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803810_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGSLPSPSSSAVPADHG
KJ803759_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ410519_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173334_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173312_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173311_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173285_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF495606_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KC875271_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875267_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875264_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774231_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774228_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774220_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSTVPADHG
KC774210_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774184_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSTVPADHG
KC164151_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164150_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164149_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164148_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164147_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164146_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164145_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164144_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164143_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164142_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164141_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164140_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164139_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164138_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164137_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164136_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164135_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164134_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164133_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164132_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164131_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164130_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164129_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164128_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164127_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164126_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVRADHG
KC164125_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164124_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164123_HBx_P-C          MAAGLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164122_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164121_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164120_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164118_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164117_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164116_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164115_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164114_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164113_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164112_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164111_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164110_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164109_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164108_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164106_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164105_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164104_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164103_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164102_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164101_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164100_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164088_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164087_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164086_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSTSSSAVPADHG
KC164085_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
JQ801505_HBx_P-C          MAARLCCQLDPTRNVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ801504_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGALPSPSSSAVPADHG
JQ801488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
JQ341898_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341890_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JQ040127_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JQ027318_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418552_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ924643_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPADHG
GQ924622_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPADHG
GQ855530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
FJ386625_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSTSSSAVPADHG
FJ386603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032338_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ032336_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ023656_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023653_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023647_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSPSAVPADHG
FJ023646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939558_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU670263_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU589345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306676_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306673_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306671_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
EU305542_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU305541_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EF688062_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089786_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
DQ089782_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089781_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
DQ089769_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY251140_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY251135_HBx_P-C          MAAMLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
AY251134_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AY167099_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
AP011107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223955_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB931171_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHG
AB931170_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHG
AB300363_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPADHG
AB246344_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB198077_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB111125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111124_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
Z35717_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X70185_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
X51970_HBx_P-A            MATRLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
V00866_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MN507849_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
MF772350_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772349_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KU605532_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
KT749849_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749847_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749846_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749842_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749839_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749834_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749833_HBx_P-A          MAARLCCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749832_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749826_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749825_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749822_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
KP995108_HBx_P-A          MAAVLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718100_HBx_P-A          MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718094_HBx_P-A          MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843216_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843215_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843188_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
L13994_HBx_P-A            MGARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EF494378_HBx_P-RF-CA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR013855_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
Z72478_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X02763_HBx_C-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK106253_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
MT426099_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426098_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESPGRPLSGPLGTLSSPSPSAVPADHG
MT426097_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426096_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426095_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426094_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MH932713_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592170_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592169_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592168_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC517161_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458431_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458430_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC430617_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311243_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311242_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311241_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC074724_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY886219_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY382410_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY003230_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827298_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827297_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827296_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827295_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827294_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827293_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749850_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749844_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749843_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749840_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749838_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749837_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749836_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749835_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749831_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749830_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749829_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749824_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KP718102_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718101_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718099_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718098_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718097_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718096_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718095_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718093_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718092_HBx_P-A          MAARLXCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718089_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718088_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718087_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP274928_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP274927_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP274925_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606749_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606746_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606742_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM519454_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854710_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854708_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843218_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843217_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843214_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843192_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843186_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843182_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843173_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHG
KJ843166_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ586809_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718091_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX310722_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
JX310723_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ854709_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718090_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HQ700475_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPAXHG
HQ700504_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700558_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700559_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLPSPSPSAVPANHG
HQ700561_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
JN688720_HBx_P-F          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KP148538_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
JN104438_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX870000_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
HQ700567_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700566_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGTLPSPSPSAVPANHG
HQ700565_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700563_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGGLSSPSSSAVPANHG
HQ700562_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700568_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700573_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
AB900115_HBx_P-C          MAARLCCQLDPARDVLCLRPVGDESRGRPVAGPFGPLSSPSSAAVPADHG
KJ173320_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
KJ173322_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
MZ439613_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
DQ089800_HBx_P-C          MAARVCCQLDPARDVLCLRPVDTESCGRPLTGPLGTLPSPSSSAVPAVHG
JQ707306_HBx_P-A          MADRLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477500_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTFSSPSPSAVPADYG
AB074047_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPFGTLPSPSSSAVPADYG
KR812078_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KR812086_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
AB205118_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB480036_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB246338_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB453981_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697506_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697507_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
KR811913_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ904423_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU717212_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF182804_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
KJ843184_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
JQ707659_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707642_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTLSSPSPSAVPADHG
JQ707617_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707611_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707589_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLETLSSPSPSAVPADHG
JQ707532_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
JQ707543_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707551_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707613_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707618_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707625_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707644_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707648_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707650_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707414_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGSLGTLSSPSPSAVPADHG
JQ707405_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707403_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707400_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707402_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707397_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707383_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707371_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707372_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707373_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707374_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707375_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707377_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707378_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707379_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707381_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707382_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707384_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707386_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707387_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707388_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707390_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707391_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707392_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707393_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707394_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707395_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707396_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707399_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707404_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707406_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707407_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707408_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707409_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707410_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707411_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707412_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707413_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707415_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707416_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707417_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707418_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707419_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707420_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707626_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707362_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707348_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707329_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707317_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707318_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707299_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707300_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707301_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707302_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707303_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707304_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707305_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707307_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707308_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707309_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707310_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707311_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707312_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707313_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707314_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707315_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707316_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707319_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707320_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707321_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707322_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707323_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707324_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707325_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707326_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707327_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707328_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707330_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707331_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707332_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707333_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707334_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707335_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707336_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707337_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707338_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707339_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707340_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
JQ707341_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707342_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707343_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707344_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707345_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707346_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707347_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707349_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707350_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707351_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707352_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707353_HBx_P-A          MAARLYCQLDPSRDVLCFRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707354_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707355_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707356_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707357_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707358_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707359_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707360_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707361_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707363_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707364_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707365_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707366_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707367_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707368_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707369_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707370_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707376_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707389_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707398_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477486_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ184323_HBx_P-A          MAARLYSQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
EU859949_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859944_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
EU859932_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
EU859917_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859900_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU747320_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ298161_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADRG
AY862868_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHG
AY738140_HBx_P-A          MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738139_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738141_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738142_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738143_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY233280_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
AY128092_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHG
AF297622_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937797_HBx_P-A          MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB246337_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
AB064314_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116077_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116079_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116080_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116081_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB126580_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB222707_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300366_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300367_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB362931_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB453979_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453980_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453982_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453983_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB480038_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480039_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480040_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480041_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB549213_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697488_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697489_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697491_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697492_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697493_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697495_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697496_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697497_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697498_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697499_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697501_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697503_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697504_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697505_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697508_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697509_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697511_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697512_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775198_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775199_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775200_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775201_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937792_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937793_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937794_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937798_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF043580_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090839_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090840_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090841_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
AF536524_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ012207_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM282986_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295795_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295796_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295797_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295798_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295799_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM410963_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY707087_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY862867_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY902775_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ788725_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU086721_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185786_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185787_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185788_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185789_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU414133_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594383_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594384_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU594386_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU594388_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594389_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594390_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594391_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594392_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594393_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594394_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594395_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859898_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859899_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859902_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859903_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859904_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859905_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859906_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859907_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859908_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859909_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859910_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859911_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859912_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859913_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859914_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859915_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859916_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859918_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859919_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859920_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859921_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859922_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859923_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859924_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859925_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859926_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859927_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859928_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859929_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859931_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859933_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859935_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859936_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859937_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859938_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859939_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859940_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859941_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859942_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859943_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859945_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859946_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859947_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859950_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859951_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859953_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859954_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859956_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ349224_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ184324_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
GQ414522_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477461_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477462_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477464_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477467_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477470_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477474_HBx_P-A          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477477_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477482_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477488_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477491_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477494_HBx_P-A          MAAKLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477497_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477503_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477504_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563546_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVPADHG
GU563553_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563554_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563555_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
GU563557_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563558_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576988_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576989_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687529_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687533_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707531_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707535_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707536_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707537_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707538_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707539_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707540_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707541_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707542_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707544_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707545_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707546_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707547_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707548_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707549_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707550_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707552_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707553_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707554_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707555_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707556_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707557_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707558_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707559_HBx_P-A