HBVdb

Dataset for protein HBx of genotype all

[Download (right click)] [Sequences] [Repertoires]

12589 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


JX504531_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN792908_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
KU605535_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
EF103281_HBx_P-D          MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
EU939556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
JN688713_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC164004_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
AB205121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KC163999_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
AB014370_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB064314_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB076678_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB076679_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AB116076_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHG
AB116077_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116078_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116079_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116081_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116082_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116083_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
AB116084_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116085_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116086_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPAPSAVPSDHG
AB116087_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPSAVPSDHG
AB116088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116089_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116090_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB116091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPFAGSLGTLSSPSPSAVPSDHG
AB116092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGAVSSPSPSAVPSDHG
AB116093_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AB116094_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
AB194950_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB194951_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
AB194952_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVPTDHG
AB205118_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB241114_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
AB241115_HBx_P-A          MAARVYCQLDTSRDVLCLRPISAESRGRPLARSLGTLSSPSPSAVPSDHG
AB246317_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB246335_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB246336_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGALSSPSPSAVPSDHG
AB246337_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
AB246338_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB362931_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB453984_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453986_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB453987_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB453988_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLAGSLGTLSSPSPSAVPSDHG
AB453989_HBx_P-A          MAARMYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB480040_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697487_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697498_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937791_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
AB937795_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB937797_HBx_P-A          MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF043560_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
AF043580_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090838_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090841_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
AF143298_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF143302_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF297621_HBx_P-A          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AF297622_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF297623_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGSLGTLSSPSPSAVPSDHG
AF297624_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AF297625_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AJ309369_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ309371_HBx_P-A          MTARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ344115_HBx_P-A          MAARLFCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ627226_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
AJ627227_HBx_P-A          MAARLCCQLDPSRDVLCLRPVXAESRGRPLSGPLGALSSPSPSAVPAVHG
AM180624_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGXLPSPSPSAVPTDHG
AM184125_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AM184126_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
AM494718_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY034878_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHG
AY128092_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHG
AY152726_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY161138_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161142_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY233274_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233275_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233276_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233278_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARSLGTLSSPTPSAVPSDHG
AY233279_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233280_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
AY233281_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY233282_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233283_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233285_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233286_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY233288_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AY233290_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGDLSSPSPSAVPSDHG
AY373428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY373429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY373432_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY738139_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738140_HBx_P-A          MAARLYCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738141_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY738142_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY862868_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHG
AY902775_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
AY903452_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934763_HBx_P-A          MAARMYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDDG
AY934764_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
AY934765_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934766_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934767_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
AY934769_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRRRPLAGPLGTLSSPSPSAVPSDHG
AY934770_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934771_HBx_P-A          MAARMYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
AY934772_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGSLSSPSPSAVPSDHG
AY934773_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
AY934774_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
DQ020002_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
DQ020003_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
DQ298161_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADRG
DQ298162_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ298163_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ315784_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315785_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
DQ315786_HBx_P-A          MAARLYCQLDTTRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
DQ788728_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EF103278_HBx_P-A          MAARLYCQLDSSRDVLSLRPVGAESRGRPLARPLGAVSSPSPSAVPSDLG
EF208113_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU054331_HBx_C-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPFGHFSSPSLSNIPNDHG
EU366129_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
EU414133_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594385_HBx_P-A          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594387_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU747320_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859900_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859901_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859903_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859906_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859917_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859927_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859932_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
EU859934_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSTVPADHG
EU859938_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859941_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859944_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
EU859948_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859949_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859952_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
FJ349224_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ349296_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
FJ692554_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
FJ692557_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692558_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692559_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692561_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692562_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDNG
FJ692563_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692564_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692566_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARPLGTLSSPSPSAVPSDHG
FJ692567_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692570_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFEGSLGTLSSPSPSAVPSDYG
FJ692571_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692572_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFTGSLGTLSSPSPSAVPSDHG
FJ692573_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692574_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692575_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
FJ692576_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692577_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFAGSLGTLSSPSPSAVPSDHG
FJ692587_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSTSPSAVPSDHG
FJ692590_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692592_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FJ692593_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692595_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692597_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692598_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692599_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692601_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692602_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692603_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPAXHG
FJ692605_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692606_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692607_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FJ692608_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692609_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692610_HBx_P-A          MAXRLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692612_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPTDHG
FJ692613_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGSLSSASPSAVPTVHG
FJ904411_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
FM199974_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLXSPSPSAVPSDHG
FM199975_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199976_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199977_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199979_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FM199981_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FN545825_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGSVSSPSPSAVPTDHG
FN545826_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545828_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVPTDHG
FN545829_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545830_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPISSPSPSAVSTDHG
FN545831_HBx_P-A          MAARLYCQLDSSRNVLCLRPVDAESRGRPLSGPLGALSSPSPSAVPTDHG
FN545832_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545833_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545834_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545835_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
FN545836_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
FN545837_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545838_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FN545839_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
GQ161813_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ184323_HBx_P-A          MAARLYSQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
GQ184324_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPGTLSSPSPSAVPADHG
GQ331046_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477462_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477463_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477465_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477466_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVPADHG
GQ477469_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPAVHG
GQ477472_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477473_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477474_HBx_P-A          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477475_HBx_P-A          MAARLYCQLDPSRDVLCLRAVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477478_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477479_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESSGRPLSGPLGTLSSPSPSAVPTDHG
GQ477480_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
GQ477486_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477487_HBx_P-A          MAARLYCQLDPSRDVFCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477488_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477490_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
GQ477494_HBx_P-A          MAAKLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477498_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477499_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
GQ477500_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTFSSPSPSAVPADYG
GQ477502_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563545_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563546_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVPADHG
GU563547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563550_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563551_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563557_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563562_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HM011485_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGALSSPSPSAVPSDHG
HM535200_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLEGPLGTLSSPSPSAVPSDHG
HM535205_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
JN182318_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182321_HBx_P-A          TAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182322_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182323_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182324_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182325_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182330_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JQ707299_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707306_HBx_P-A          MADRLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707309_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707317_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707329_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707335_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707340_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
JQ707348_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707351_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707353_HBx_P-A          MAARLYCQLDPSRDVLCFRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707362_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707368_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707371_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707374_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707376_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707380_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707383_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707397_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707400_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707403_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707405_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707411_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707414_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGSLGTLSSPSPSAVPADHG
JQ707418_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGALSSPSPSAVPADHG
JQ707532_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
JQ707535_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707537_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707543_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707551_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707560_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707568_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707581_HBx_P-A          VAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707582_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707589_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLETLSSPSPSAVPADHG
JQ707592_HBx_P-A          MAAGLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707604_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVPADHG
JQ707611_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707617_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707625_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707626_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707642_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTLSSPSPSAVPADHG
JQ707659_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707672_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX154579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX310722_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
JX310723_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KC875251_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875252_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875253_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875254_HBx_P-A          MAARLYCQLDSTRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875255_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875256_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSTSAVPSDHG
KC875257_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESPGRPLARPLGAVSSPSPSAVPSDHG
KC875258_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875259_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KC875260_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPADHG
KF214657_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214658_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214659_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF214660_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSASAVPSDHG
KF214661_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214662_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
KF214663_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214665_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KF214666_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF922406_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922414_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922417_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922420_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922424_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922429_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922434_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KF922435_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KF922437_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010776_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ843172_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843173_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAAHG
KJ843183_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ843184_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTVSSPSPSAVPADHG
KJ843188_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843215_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ854685_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854686_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KJ854687_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854688_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KJ854689_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854690_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSSSAVPSDHG
KJ854691_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ854692_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPSDHG
KJ854694_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854695_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854696_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854699_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854700_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGSLSSPSPSAVPSDHG
KJ854701_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854703_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
KJ854704_HBx_P-A          MAARLYCQLDSSRDVLCLRSVCAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854705_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ854707_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTRPLGNLSSPSPSAVPSDHG
KJ854709_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM243029_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KM519452_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KM519454_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606737_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
KM606748_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168422_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSPSAVPSDHG
KP168423_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGPLSSPSTSTVPSDHG
KP168424_HBx_P-A          MAARVYWQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
KP168425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP168426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGTLGTLSSPSPSAVPSDHG
KP168427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRXRPLAGPLGALSSPSPSAVPSDHG
KP168428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGALSSPSPSAVPSDHG
KP168429_HBx_P-A          MAARLYCQLDSSRDILCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168430_HBx_P-A          MAARLYCQLDSSRNVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVXAESRGRPLARPLGTLSSPSPSAVPSDHG
KP168432_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168433_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
KP168434_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLARTLGSVSSPSPSTVPSDHG
KP168435_HBx_P-A          MAARVCCQLDSSRDVLCLRSVGAESRGRPLSGPLGALSAPSPSAVPSDHG
KP718085_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRXLAGPLGTLSSPSPSAVPSDHG
KP718086_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP718090_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718092_HBx_P-A          MAARLXCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718093_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718094_HBx_P-A          MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718102_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP995108_HBx_P-A          MAAVLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR905425_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KR905426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905429_HBx_P-A          MAARLYCQLDSSRDVLRLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT151611_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXSFGAVSSPSPSAVPSDHG
KT151612_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151613_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGBVSSPSPSAVPSDHG
KT151614_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTVSSPSPSAVPSDHG
KT151615_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151616_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGAVSSPSPSAVPSDHG
KT151617_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAXPLGTLSSPSPSAVPSDHG
KT151618_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KT347087_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGALSSPSPSAVPSDHG
KT347088_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KT347091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KT749822_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
KT749825_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749833_HBx_P-A          MAARLCCQLDPSRDVLCLRPIGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749840_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749842_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KU605532_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
KU605533_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605534_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
KU605536_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605537_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU736918_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736919_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KU736920_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGALSSPSPSAVPSDHG
KX276769_HBx_P-A          MAARVYCQLDSSRDVLCLRPVXAESRGRPLAGSLGTLSSPSPSAVPSDHG
KX357643_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357644_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357645_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357647_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSNHG
KX357649_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRSLARPLGSLSSPSSSAVPSDHG
KX357650_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KX648547_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KX648549_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
KX827298_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
L13994_HBx_P-A            MGARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC051141_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
LC462120_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
LT992441_HBx_P-A          MAARLYCQLDSSRDILCLRPVGAESRGRPLSGPLGFLSSPSPSAVPADHG
M57663_HBx_P-A            IAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
MF772344_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772345_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
MF772346_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MF772347_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772348_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772350_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MF772351_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MF925362_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPSDHG
MF925368_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
MF925372_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSLSAVPSDHG
MF925373_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPFARPLGTVSSPSPSAVPSDHG
MF925385_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MF925400_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGDLSSPSPSAVPSDHG
MF925407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MG877723_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464808_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLTGPLXTLSSPSPSAVPSDHG
MH464809_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464810_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464811_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464812_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVSSVHG
MH464813_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464817_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MH464825_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH580627_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MK512456_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512457_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512458_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSTVPSDHG
MK512461_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512462_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512463_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512464_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGSESRGRPLAGPLGTLSSPSPSAVPSDHG
MK512465_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSSSPSAVPSDHG
MK512466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512468_HBx_P-A          MAPRLLCQPDSSRDVLCLRPVGAESRGRPLQGPLGALSSPSPSAVPSDHG
MK512469_HBx_P-A          MAARLYYQQDSSLDVLCLRSVGAESRARPLQVPPGTGSSPSPSAIPSYHG
MK512470_HBx_P-A          MAARLYCQLDSSRDVLCLRHVGAESRGRPLQETLGTLSSPSPSAVPSDHG
MK512471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGALGTLPSPSPSAVPSDHG
MK512472_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
MK512474_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512475_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512476_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512477_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGPLSSPSPSAVPSDHG
MN053840_HBx_P-A          --ARLYCQLDSSRDVLCLRPVGAESRGRPFARSLGTLSSPSPSAVPSDHG
MN476101_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLARPLGSVSSPSPSAVPSDHG
MN476102_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARPLGNLSSPSPSAVPSDHG
MN544634_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MN585096_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVPADHG
MN585097_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPTDHG
MT114170_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGDVSSPSPPAVPSDHG
MT210032_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT210034_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGXLSSPSPSAVPSDHG
MT426088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
MT426090_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426092_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGPLGSLSSPSPSAVPSDHG
MT426093_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRSLSGPLGTFSSPSPSAVPADHG
MT426097_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426098_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESPGRPLSGPLGTLSSPSPSAVPADHG
MT622525_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLSGPVGTLSSPSPSAVSPDHG
MW567976_HBx_P-A          MAARLCCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043025_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043026_HBx_P-A          MAARLYCQLDPSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043027_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043028_HBx_P-A          MAARLYCQLDPSRDVLCLRPVDAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043029_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
MZ043030_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
MZ043031_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043032_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043033_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGPLSSPSQSAVPAVHG
MZ043034_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043035_HBx_P-A          MAARMYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043036_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043037_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043038_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043039_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043041_HBx_P-A          MAARLYCQLDSSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MZ043043_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043044_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
MZ043045_HBx_P-A          MAARLYCQLDPARDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043046_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043047_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGNLSSPSPSAVPADHG
MZ043048_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043049_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043050_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043052_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPPAVPADHG
MZ043053_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTISSPSPSAVPADHG
MZ043054_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
MZ043055_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043056_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPAVHG
MZ043057_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPAVHG
MZ043058_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043059_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043060_HBx_P-A          MAARLYCQLDPSRNVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043062_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043063_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043064_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043065_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043067_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043068_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043069_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
MZ043071_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043073_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043074_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043075_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043076_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPAVHG
MZ043077_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043078_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVPADHG
MZ043080_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043081_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043085_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043086_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
MZ043087_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043088_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043089_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MZ043092_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043093_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043095_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043096_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGDESRGRPLARPLGAVSSPSPSAVPSDHG
MZ043097_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ093431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
OK143478_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143482_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143492_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143495_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK274310_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLARPLGAVSSPSPSAVPSDHG
OK998526_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OM304326_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
ON585698_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
ON585700_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
ON585702_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
X51970_HBx_P-A            MATRLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X70185_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGSLSSPSPSAVPADHG
AB010289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB010290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
AB010292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSPVPTDHG
AB031266_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
AB031267_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
AB033554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB033555_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPSSPSAVPTDHG
AB048705_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGDLPSPSASTVPTIDG
AB073821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVSTXHG
AB073822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
AB073823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB073824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
AB073826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTKHG
AB073828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
AB073831_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGIPTDHG
AB073832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTNHG
AB073833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB073836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073837_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGPLPPAFPSAVPTDHG
AB073843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB073844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPATPSAVPTDHG
AB073845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPPDHG
AB073846_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRRRPLPGPLGALPPASPSAVPTDHG
AB073847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB073849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AB073850_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
AB073852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGDESRGRPLPGPLGALPPASPSAVPTDDG
AB073854_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073855_HBx_P-B          MAARMCCQLDTARDVLCLRPVGAESCGRPLSGPLGALPPASPSAVPTDHG
AB073856_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
AB073857_HBx_P-B          MAARLCCKLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB073858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB100695_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHG
AB104890_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB104891_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB106884_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPPGAIPPASPSAVPTDHG
AB115551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB117759_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB195933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB205119_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB205122_HBx_P-B          MAARLYCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB212625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
AB212626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB219426_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219427_HBx_P-B          MAARLCCQLDPARDVLCLRPLSAESRGRPLPGPLGALPPASPSAVPTDHG
AB219428_HBx_C-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
AB219429_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTDHG
AB219430_HBx_P-B          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
AB231909_HBx_P-B          MAARLCRQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
AB241116_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB246339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AB246340_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB246341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
AB246342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
AB246343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPAVPTDHG
AB287314_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287317_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287319_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287320_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPPDHG
AB287321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
AB287322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB300364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB300370_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPPDHG
AB302095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB302942_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTIHG
AB362933_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB365445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB368295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSSASPSAVPTDHG
AB471854_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB493827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB493833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPTIHG
AB493835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB555498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB555499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB642093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
AB642094_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
AB642101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB675676_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSPDHG
AB713527_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB713528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
AB713529_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713530_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB713531_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB828708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB900095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900097_HBx_P-B          MAARLCCQLDPTRDVVCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900102_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
AB900103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
AB900105_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSAVPTDHG
AB900107_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900108_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPAVPTDHG
AB900110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB900111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB900112_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AB931168_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AF100308_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTVHG
AF100309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVLPTDHG
AF121243_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
AF121246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
AF121247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPSDHG
AF121248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF121251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPSDHG
AF282917_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPLVPTDHG
AF282918_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AF461360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF479684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPIVPTDHG
AJ627225_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
AP011084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPTSPPGVPTDHG
AP011086_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
AP011087_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
AP011088_HBx_P-B          MAARLCCQLDPTRDVLYLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011089_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTIHG
AP011090_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011092_HBx_P-B          MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AP011093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAVPTDHG
AP011094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AP011095_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPAIPTDHG
AP011096_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY033072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY163869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
AY167089_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPLVPTVNG
AY167094_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY167098_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
AY167101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPATPPIVPTDHG
AY206373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AY206375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY206383_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY206387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
AY206390_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
AY206391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPIVPTDHG
AY217356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AY217357_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLRAVPPASPPAVPTDHG
AY217368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
AY220697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY283777_HBx_P-B          MAARLCCQLNPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY293309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
AY310322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY518556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596103_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596106_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596109_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
AY596110_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTYHG
AY596111_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
AY766463_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
AY800389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
AY800391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPTASPSAVPTDHG
D00330_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
D00331_HBx_C-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
D23678_HBx_P-B            MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLRALPPASPSAVPSDHG
D23679_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ361535_HBx_P-B          MAARLCCQLDPARDVLCLHPVSAESRGRPLSGPLGALPPTSPSVVPTDHG
DQ377158_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ448621_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448625_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
DQ448627_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPCVPTDHG
DQ463787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
DQ463790_HBx_P-B          MAARLCCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463791_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGTLGAVPPASPPAVPTDHG
DQ463792_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
DQ463796_HBx_P-B          MAARLYCQLDPARDVLCLRPVEAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPDSPPAVPTDHG
DQ463799_HBx_P-B          MAARLCCQLDPARDVLCLRPVAAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463800_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ463801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
DQ463802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
DQ904357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
DQ993681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPSPPSAVPTDHG
DQ993682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
DQ993684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993685_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSAVPADHG
DQ993686_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
DQ993687_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
DQ993694_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPAVPTDHG
DQ993696_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
DQ993701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDNG
DQ993702_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESPVLPLPGLLGALPPASPPVVPTDHG
DQ993703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ993704_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
DQ993710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
DQ993711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPDVPTDHG
DQ995802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
DQ995803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
DQ995804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
EF134945_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF134946_HBx_P-B          MAARLCCQLDPARDILYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPAAVPTDHG
EF473973_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EF473974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473975_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF473977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
EF494380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EF494381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
EF494382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU043344_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU139543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPSDHG
EU158263_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPVVPTVHG
EU305547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU305548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU306699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306700_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306701_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306708_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU306712_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
EU330989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330992_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330994_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU330996_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
EU350409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439018_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439021_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU439023_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU487256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPVVPTDHG
EU487257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU522067_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU522072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU522074_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU547563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU564823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU564826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPDVPTDHG
EU570069_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAVSRGRPLPGPLGALPPASPPVVPTDLG
EU570071_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDLG
EU570075_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU579441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU589335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU595031_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU660233_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
EU796066_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796067_HBx_P-B          MAARLCCQLGPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
EU796068_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU796071_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU881997_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU881998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
EU882002_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882003_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU882004_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU919172_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
EU919175_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
EU939559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939633_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939634_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPLVVPTDHG
EU939636_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939637_HBx_P-B          MVGRLYFQLDPARDVLFLRPVGDESRGRPFPGPLGDLPSASPPVVLTDHG
EU939638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
EU939639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
EU939661_HBx_P-B          MAGRLCCQLDTARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
EU939663_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU939664_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939665_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPXVPTDHG
EU939669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
EU939670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939671_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
EU939672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
EU939674_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU939675_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939676_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
EU939677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTEHG
EU939679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023631_HBx_P-B          MAARLCCQLDPARDVLCLRPIGAESRGRPLPGPLGPVPPASPPVVPTDHG
FJ023632_HBx_P-B          MAARLCCQLDPARDVLCLCPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
FJ023633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSTVPADHG
FJ023635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
FJ023636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ023637_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
FJ023638_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPATPSAVPTDHG
FJ032342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032344_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ032353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032354_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
FJ349236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPSAVPTDHG
FJ386583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGHLSPASPPCVPTDHG
FJ386584_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
FJ386600_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
FJ386608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDDG
FJ386615_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
FJ386634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386648_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPXXVPTDHG
FJ386655_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPASPPIVPTDHG
FJ386656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
FJ386668_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
FJ386669_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ386681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ386684_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ386688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ518811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
FJ518812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
FJ562234_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
FJ562236_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPIVPTDHG
FJ562240_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562257_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLSPASPPCVPTDHG
FJ562259_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562262_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPCVPTDHG
FJ562296_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562303_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
FJ562311_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562312_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562322_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
FJ787444_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ787475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ787476_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPAVPTDHG
FJ787477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ899779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
FJ899785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899786_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPSASPPVVPTDHG
FJ899787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPSASPPAVPTDHG
GQ358136_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ358137_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358138_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPTDHG
GQ358143_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358144_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPSDHG
GQ358145_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGAVPPASPSAVPSDHG
GQ358146_HBx_P-B          MAARLCCQLDLARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPSDHG
GQ358148_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ358149_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPPDHG
GQ358150_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
GQ358151_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
GQ377525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377537_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377542_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
GQ377547_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377550_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPIVPTDHG
GQ377567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPYVPTDHG
GQ377568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
GQ377582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377587_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377588_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377612_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ377622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
GQ377625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ377638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
GQ377641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
GQ377643_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
GQ377644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
GQ475340_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855522_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ855526_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPAPPSPVPTDHG
GQ855529_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GQ855689_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
GQ924605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
GQ924606_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPVVPTDHG
GQ924607_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
GQ924608_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPIVPTDHG
GQ924617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
GQ924624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGTLGTLPPASPPAVPTDHG
GQ924625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
GQ924627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
GQ924628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPAASPSAVPTDHG
GQ924630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924631_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924632_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ924637_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPSAVPTDHG
GQ924640_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTVHG
GQ924645_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESRGRPLPGPLGALPPASPSAVPTDHG
GQ924647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVSTDHG
GQ924651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPTDHG
GQ924653_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924656_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
GU434372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPPVVPTDHG
GU434373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU451682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815560_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPASPPVVPTDHG
GU815573_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815574_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815578_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815583_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPGVPTDHG
GU815590_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815605_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
GU815623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
GU815637_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
GU815653_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
GU815656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815669_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
GU815670_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815685_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815688_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815692_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
GU815704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815707_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815721_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815722_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815723_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815724_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPADHG
GU815726_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDRG
GU815732_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPGVPTDHG
GU815733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815738_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
GU815747_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815772_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815780_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
HM011467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
HM011469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HM011470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPGVPTDHG
HM011474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPLAVPTDHG
HM011475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
HM011476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
HM011477_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPLDVPTDHG
HM011478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011482_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPSDHG
HM011487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
HM011490_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVSTDHG
HM011492_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
HM011494_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
HM011496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
HM011499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPADHG
HM011503_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HM011504_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
HQ700546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPTDHG
HQ700548_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGAVPPASPSAVPTDHG
HQ700549_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGAVPPASPSAVPTDHG
JF412801_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF436921_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JN406371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JN792894_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPTSPPAVPTDHG
JN792900_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
JN792901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPPSPSAVPPDHG
JN827419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027311_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPAVPADHG
JQ027313_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPVVPTDHG
JQ027316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSXVPTDHG
JQ027325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027329_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027330_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ027334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPXAVPTDHG
JQ040128_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPTDHG
JQ040138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTDHG
JQ040147_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040157_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ040170_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JQ040171_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040173_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPLVPTDHG
JQ341793_HBx_P-B          MAARLCCQLDLTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
JQ341795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341797_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
JQ341799_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341800_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
JQ341804_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLXALPPASPPGVPTDHG
JQ341809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPADHG
JQ341811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXXPTDHG
JQ341812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPLIPTDHG
JQ341813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVIPTDHG
JQ341814_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
JQ341816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341818_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
JQ341821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JQ341822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTNHG
JQ341823_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPAASPPVVPTDHG
JQ341824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPAPPSAVPTDHG
JQ341825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JQ341827_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
JQ341830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
JQ341831_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLXGPLGALPPASPPVVPTDHG
JQ341833_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPAVPTDHG
JQ341835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
JQ341836_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPPVXPTDHG
JQ341838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341839_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341840_HBx_P-B          MAARLCCQLDPARDVLCLRPVXAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ341843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPSDHG
JQ341845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ341848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
JQ341850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVXPTDHG
JQ341853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
JQ429079_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429080_HBx_P-B          MAARLCCQLDPARGVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JQ429081_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
JQ429082_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
JQ707734_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707736_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707740_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ707741_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707744_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALQPASPSAVSTDHG
JQ707757_HBx_P-B          MVARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
JQ707758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
JQ707762_HBx_P-B          MAARLCCQLDPERDVLCLRPVGAESRGRPLPGPLGALPPASPPAVSTDHG
JQ801471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
JQ801474_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801506_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPSVPTDHG
JQ801507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDQR
JQ801512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
JQ801514_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX026879_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPFVPTDHG
JX026883_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
JX026886_HBx_P-B          MAARLCCQPDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX429897_HBx_P-B          MAARLCCQLDPARDVLSLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX429899_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSDHG
JX429900_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
JX429901_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX429902_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
JX429908_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504532_HBx_P-B          MAARMCCQLDPARDVLCLRPVSAESRGRPLPGSLGALPPASPPVLPTDHG
JX504533_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX504538_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX507210_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX507213_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX507215_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661470_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPSNYG
JX661471_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JX661473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPHLVPTDHG
JX661475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
JX661479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPVVPTDHG
JX661480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPIVPTDHG
JX661481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVFPTDHG
JX661482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661483_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDYG
JX661484_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
JX869999_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
JX870001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPAVPTDHG
JX978431_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC163805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163809_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLEALPPASPPVVPTDHG
KC163810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KC163814_HBx_P-B          MAARLCCRLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC163829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC492739_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPIVPTDHG
KC510644_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC510646_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510648_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC510652_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC510653_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLRALPPASPPFVPTDHG
KC510654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510656_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KC510657_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLIPTDHG
KC510659_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPCVPTDHG
KC510660_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDPG
KC774363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774365_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPIVPTDHG
KC774367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KC774368_HBx_P-B          MGGRLCCQMDPARDVLCLRPVGAESRGRPLPGPLGALPPAFPPVVPTDHG
KC774369_HBx_P-B          MAARVCCQMDPARDVLCLRPVGAESRGRPPPGPLGALPPASPFAVPTDHG
KC774370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAFPSAVPTDHG
KC774372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDPG
KC774373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774375_HBx_P-B          MAGRLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGDLPPASPPVVPTDHG
KC774376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVLPTDHG
KC774378_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KC774380_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
KC774381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KC774382_HBx_P-B          MAGRVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774383_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPTPPPVVPTDHG
KC774387_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KC774389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KC774390_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KC774391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLTGPLGALPPASPPIVPTVHG
KC774395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774396_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774398_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774399_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774402_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPASPPVVPTIHG
KC774404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPPVVPTDHG
KC774405_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLRALPPASPPAVPTDHG
KC774406_HBx_P-B          MAARLCCQLDPARDVICLRPVGAESCGRPLPGPLGALPPASPPCVPTDHG
KC774407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC774411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KC774412_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTNHG
KC774416_HBx_P-B          MAARVCCQLDPTRDVLYLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KC774417_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KC774418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPTASPSAVPTDHG
KC774419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KC814873_HBx_P-B          MAARVCCQLTNAREVLCLRPVGAESRGRPLPGPLGALPSASSPAVPTDHG
KC814875_HBx_P-B          FAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
KC814883_HBx_P-B          MAARVCCQLTNRREVLCLRPVGAESRGRPLSGPLGALPPPSPPAVPADHG
KC814890_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814917_HBx_P-B          KAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC814918_HBx_P-B          MAARVCCQLKLARDSLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTIHG
KJ173339_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGALPPASPPLVPADYG
KJ173341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ173347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ173351_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTTYG
KJ173352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173353_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNYG
KJ173357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRAVPPASPPVVPTDHG
KJ173359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173361_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173362_HBx_P-B          MAARLCCQLDPARDVICLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KJ173369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KJ173375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173380_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173384_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173386_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KJ173387_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KJ173388_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173397_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KJ173401_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRSLPGPLGALPTASPSAVPTDHG
KJ173409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KJ173411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
KJ173416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESGGRPLPGPLGALPPASPPIVPTDHG
KJ173420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KJ173422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPPDHG
KJ410490_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ410500_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ410502_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ410507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVVPTDHG
KJ790200_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803752_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803756_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803758_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803763_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803764_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KJ803768_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPTASPPVVPTDHG
KJ803781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSAVPTDHG
KJ803789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803796_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803801_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
KJ803805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
KJ803817_HBx_P-B          MAARLCCQLDPARDVLWLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803820_HBx_P-B          MAARLCCQLDTARNVLCLRPVGAESRGRPLPGSLGALPPASPPAVPTDHG
KJ803824_HBx_P-B          MAARLCCQLDPSRDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPASPHLVPTDHG
KJ843165_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213032_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
KM213036_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM359440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KM392072_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
KM875418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM875426_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KM875427_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KP148314_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148317_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148318_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148324_HBx_P-B          MAARLCCQLGPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148326_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148327_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148329_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALSPASPPVVPTDHG
KP148330_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148335_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148338_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148339_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDYG
KP148343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADYG
KP148344_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDYG
KP148345_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
KP148356_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148361_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148362_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148363_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPVVPTDHG
KP148367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAGSRGRPLPGPLGALPPASPSAVPTDHG
KP148368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDYG
KP148371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148372_HBx_P-B          LAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148379_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
KP148383_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148394_HBx_P-B          MAARLCCQLDPARYVLCLRPVGAESRGQPLPGPLGALPPASPSAVPTDHG
KP148405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KP148410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148411_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDRG
KP148415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPPPGPLGALPPASPSAVPTDHG
KP148419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRLLPGPLGALPPASPSAVPTDHG
KP148420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148426_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP148452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148453_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148457_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPHGALPPASPSAVPTDHG
KP148458_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
KP148461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPSSPSAVPTDHG
KP148579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148583_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP659219_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659220_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KP659223_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659224_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659234_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659235_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659246_HBx_P-B          MAARXCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALPPXSPSAVPTDHG
KP659250_HBx_P-B          MAARLCCQLDPARDFLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
KP659251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659252_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
KP659253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVSTDHG
KP659254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVXTDHG
KR152339_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KR232337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPTASPPVVPADHG
KR811974_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
KR811976_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR811977_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812005_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812006_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812008_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
KR812009_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812011_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812015_HBx_P-B          MAARPCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
KR812017_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASASAVSTDHG
KR812029_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812035_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812038_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KR812039_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KT749820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU234318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
KU679959_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU963816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KU963824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
KU963828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963948_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963952_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVVPTDHG
KU963958_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KU963962_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTAHG
KU963967_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963971_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU963989_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964093_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAYPPVVPADHG
KU964114_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964115_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KU964125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964137_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964138_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KU964249_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964257_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964264_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KU964272_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964287_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964301_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276770_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDHG
KX276771_HBx_P-B          MAARLCCQLDPARDVLCLRXVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276772_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KX276773_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276774_HBx_P-B          MAXRLCCQLDPARDVLCLRPVGAESRGRPLXGXLGALPPASPPVVPTDHG
KX276775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
KX276776_HBx_P-B          MAARLXCQLDXXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVXTDHG
KX276777_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
KX276778_HBx_P-B          MAARLCCQLDTTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276779_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276781_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276782_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
KX276783_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KX276784_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
KX276785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276786_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTXHG
KX276787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276788_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276789_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPASPPVVPTDHG
KX276790_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTXHG
KX276791_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276792_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPASPPVVPTDHG
KX276796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPXVPTDHG
KX276798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276799_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276800_HBx_P-B          MAARLXCQLDXARBVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276801_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPGVPTDHG
KX276803_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
KX276804_HBx_P-B          MAARLCCQLDPARDVVCLRPVGAESRGRPLPGPLGXLPPASPPVVPTDHG
KX276805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276806_HBx_P-B          MAARLCCQLDXARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGLPTDHG
KX276809_HBx_P-B          MAARLCCQLDPXRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276811_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276812_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KX276813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX276817_HBx_P-B          MAARLCCQLDPARBVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276818_HBx_P-B          MAARLCCQLDPARDVLCLRPXXAESRGRPLPGXLGALPPASPPAVPTDHG
KX276819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESXGRPLPGPLGALPPASPSAVPTDHG
KX276820_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276821_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPXSPSXVPTDHG
KX276822_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLXGPLGXLPPASPPAVPTDHG
KX276823_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276824_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX276827_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPXSPXAVPTDHG
KX276829_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPASPSAVPTDHG
KX276830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVSTDHG
KX276858_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPXVPADHG
KX429620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPSAVPTDHG
KX429622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
KX429623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPPSPSAVPTDHG
KX429628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTVHG
KX429630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429631_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429648_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429651_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPSAVPTDHG
KX765841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX765856_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPGIPTDHG
KY417926_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPSNHG
KY470830_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
KY470838_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPTVPTDHG
KY470953_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470956_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
KY470960_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPSDHG
KY629635_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
KY629636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGVESRRRPLPGPLGALPTASPSAVPTNHG
KY881721_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881780_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881781_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881782_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881784_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881785_HBx_P-B          MPARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881793_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881795_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881797_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881800_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
KY881820_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881821_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAECSEGHSTGTLRALPPASPSVVQTEHG
KY881822_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881823_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881825_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881826_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881828_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPPVPTDHG
KY881829_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881830_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881831_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881833_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881835_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPLVPTDHG
KY881836_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881837_HBx_P-B          MTARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881838_HBx_P-B          MAARLYCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLVPTDHG
KY881839_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLIPTDHG
KY881843_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KY881844_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881845_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
KY881853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPVSPPVVPTDHG
KY881856_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881860_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881862_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPADHG
KY881863_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881864_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881865_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881866_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881899_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881902_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KY881944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881945_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KY881946_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAPPPASPSAVPTDHG
KY881953_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPSAVPTDHG
KY881955_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC279268_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349868_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPADHG
LC349869_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC349871_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPASPSAVQTDHG
LC349872_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTNHG
LC349874_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349879_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
LC416037_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
LC461174_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPXGALPPASPSAVPTDHG
LC461175_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC603638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
LC677084_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALSPTSPPGVPTDHG
M54923_HBx_P-B            MAARLCCQLDPARDVLCLRSVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF059418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPPASPPVVPTDHG
MF059466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059523_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MF059620_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPPSPPVVPTDHG
MF059694_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059706_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF059719_HBx_P-B          IAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059733_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059737_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF621878_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674382_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674385_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
MF674389_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674391_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPFVPTDHG
MF674392_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAAPPSAVPPDHG
MF674393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPAPPSAVPTDHG
MF674394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVSTDHG
MF674395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPLSAVPTDHG
MF674396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674400_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674401_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674406_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPSAVPTDHG
MF674407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674410_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPAPPSAVPTDHG
MF674415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPAPPSAVPTDHG
MF674416_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674420_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674422_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVLPTDHG
MF674432_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MF674433_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPAPPSPVPTDHG
MF674434_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGXLGALPPATPSAVPTDHG
MF674437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674439_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674440_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674441_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MF674443_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674445_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674446_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674448_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLRALPPAPPSAVPTDHG
MF674449_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MF674451_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674452_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674453_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTDHG
MF674456_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674459_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674462_HBx_P-B          MAARLCCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPALPSAVPTDHG
MF674464_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674465_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPAVPTDHG
MF674469_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPEPPSAVPTDHG
MF674470_HBx_P-B          MAARLCCQLEPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPADHG
MF674473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPVPTDHG
MF674476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTVHG
MF674480_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MF674481_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPASPSAVPTDHG
MF674482_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MF674485_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPGVPTDHG
MF674487_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MF674488_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MF674491_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674492_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPFPGPLGALPPAPPSAVSSDHG
MF674495_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674500_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRRRSLPGPLGALPPAPPSAVPTDHG
MF674507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674508_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPAPPSAVPANHG
MF674509_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPSTVPTDHG
MF674511_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674512_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSTVPTDHG
MG372436_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
MG571322_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571323_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571324_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571325_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MG571326_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571327_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571333_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571338_HBx_P-B          MAARLCCQLDPARDVLCLRPVDDESRGRPLPGPLGALPPASPPVVPTDHG
MG571339_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGALPPASPPVVPTDHG
MG571340_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPIVPADHG
MG571341_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPLVPTDHG
MG571344_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPIVPTDHG
MG571346_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571347_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLLPTDHG
MG571348_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MG571350_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MG571351_HBx_P-B          MAARLCCQLDPTRNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MG571352_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MG571353_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571354_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571355_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPASPPVVPTDYG
MG571356_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPLGALPPASPPAVPTDHG
MG571357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPRLPTDHG
MG571360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESSGRPLPGPLGALPPTSPPVVPTDHG
MG571365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPVVPTNHG
MG571367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPASPPVVPTDHG
MG571369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPIVPTDHG
MG571370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571371_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
MG571373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MG571374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571376_HBx_P-B          MAARLYCQLDPARDVLCLRPVDAESRGRPLPGPLGALPPASPPVVPTDHG
MG826152_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
MG826153_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MH488811_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPIVPTDHG
MH488812_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488813_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488814_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488816_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488817_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAEPRGRPLPGPLGALPPASPPVVPTDHG
MH488818_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAVHG
MH488819_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488820_HBx_P-B          MAAWLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MH488825_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAKSRGRPLPGPLGALPPTSPPAVPTDHG
MH488826_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488832_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MH488833_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPGVPTDHG
MH488834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVIPTVNG
MH488835_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHE
MH488836_HBx_P-B          MAARLCCQLDPARDVLRLRPVGAESRGRPLPGPLGALPPASPPVVPTNHG
MH488840_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488841_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVPTDHG
MH488843_HBx_P-B          MAAGLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPGVSTDHG
MH488845_HBx_P-B          MAARLCCQLDPARDVLYLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
MH488846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
MH488848_HBx_P-B          MAAGLCCQLDPARNVLCLRPVGAESRGRPLPGSLGALPPATPPGVPTDHG
MH488851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH488855_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPLGALPPASPPLLPTDHG
MH663473_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
MH932712_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGALPPASPSAVPTDHG
MK052965_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPPVVPTDYG
MK171272_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171280_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPLVPTDHG
MK171284_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171285_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGPLGALPPASPPLLPTBHG
MK171292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171304_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHPVPTDHG
MK171306_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPPVLPTDHG
MK171321_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171331_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171334_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGPESRGRPLPGPLGALPPASPPVVPTDHG
MK171364_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171365_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDYG
MK171371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTSSPPVVPTDHG
MK171383_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171395_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171396_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGQPLPGPLGALPPASPPVVPTDHG
MK171403_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171407_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPPVVPTDHG
MK171409_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVSTDHG
MK171413_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171418_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171419_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171420_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171421_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPPVVPTDHG
MK171427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTIHG
MK171460_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
MK171466_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK171467_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPVLPTDHG
MK171468_HBx_P-B          MAARLCCQLDPARDVLCLRPVGXESRGRPLPGPLGAVPPASPPVVPTIHG
MK171475_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171476_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171495_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171498_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSVVPTDHG
MK171501_HBx_P-B          MAARLCCQLDPARNVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171507_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171515_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTIHG
MK171525_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPHVPTDHG
MK171528_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAAPPVVPTDHG
MK171536_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171542_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171545_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171579_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGVLPPASPPSLPTDHG
MK171589_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
MK171592_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171599_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK171606_HBx_P-B          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
MK171632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPTASPSAVPPDHG
MK171638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171643_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPPCVPTDHG
MK171649_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGTLGALPPASPPVVPTDHG
MK534554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534572_HBx_P-B          MAARLCCQLDPARDVLCLRPVCAESRGRPLPGPLGALPPAAPPVLPTDHG
MK534575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPPASPSAVPTDHG
MK534591_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534602_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPAVPTDHG
MK534608_HBx_P-B          MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534611_HBx_P-B          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
MK534614_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
MK534621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK534627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPADHG
MK534629_HBx_P-B          MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSPAVPADHG
MK534658_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534659_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534661_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPAVPTDHG
MK534673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
MK534676_HBx_P-B          MAARLRCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPPVVPTDHG
MK534680_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLRALPPASPSAVPTDHG
MK534691_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MK534693_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK534694_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPPGALPPASPPLVPTDHG
MK534696_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534697_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPTDHG
MK534698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSVLPTDHG
MK534699_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSAVPTDHG
MK534710_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534727_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPTSPPVVPTDHG
MK818223_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN066377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MN689117_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689118_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689119_HBx_P-B          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MN689120_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTDHG
MN689121_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPPGALPPASLSAVPTDHG
MN689122_HBx_P-B          MAARLCCQLDPARDVLCLRPVEAESRGRPVSGPFGTLPSPSSSAVPADHG
MN689123_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPPASPPAVPSDHG
MN733920_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSTVPTDHG
MN733921_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MN733922_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSTDHG
MT111595_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPASPPVVPTDHG
MT426101_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT426102_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTDHG
MT426103_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVIPTDHG
MT426104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVIPTDHG
MT622522_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPRVPTDHG
MT645001_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT645005_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPPVVPTDHG
MT645016_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MT645018_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MT645025_HBx_P-B          MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT645041_HBx_P-B          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MT757436_HBx_P-B          MAARLCCQLDPARDVLCFRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757437_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757438_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757440_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757442_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757450_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSAVPTDHG
MT757455_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALSPASPSVVPTDHG
MW310261_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW310264_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW497299_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MW845288_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAXPXAVPTDHG
MW845289_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845290_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVSSDHG
MW845291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845292_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MW845293_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845295_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845296_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLSGPHGALPPASPSAVPTVYG
MW845297_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPHLVPTDHG
MW845298_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPSAVPTDHG
MW845300_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPIGALPPAPPSAVPTDHG
MW845301_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
MW845302_HBx_P-B          MAARLCCQLDLARDVLCLRPVGAESRGRPLPGPLGALPTAPPSTVPTDHG
MW845303_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MW845304_HBx_P-B          MAARLXCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTIHG
MW845307_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845308_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845309_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLGVPTDHG
MW845310_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845311_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALSPAPPSAVPTDHG
MW845312_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSPLPTDHG
MZ439517_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439518_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ439521_HBx_P-B          MAARLGCQLDTARDVLCLRPVGAESRGRPLPGPHGAVQPASPPAVPTDHG
MZ439523_HBx_P-B          MAARLCCQLDTARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ671236_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGALSPASPPVVPTDHG
MZ671237_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
MZ675785_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPFVPTDHG
MZ675786_HBx_P-B          MAARLCCQLDPARDILCLRPVGAESRGRPLPGPLGAVPPASPPVVPTDHG
MZ675794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ675795_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
MZ675798_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MZ675802_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ675805_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
MZ934423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MZ934427_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAHPPVVPTDHG
MZ934428_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MZ934429_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPASPSAVPTDHG
MZ934430_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPASPSAVPTDHG
MZ934437_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MZ934438_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
ON402775_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
ON402778_HBx_P-B          MAARVCCQLDPARDILCLRPVGAESRGRPLPGPLGALSPGSPPVVPTDHG
ON402781_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGPLPPASPSAVPTDHG
X97850_HBx_P-B            MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPAVPTDHG
AB014360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB014361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014362_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB014363_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014364_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014365_HBx_P-C          MAARVCCQLDLARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014367_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014368_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB014369_HBx_P-C          MAARLCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLSSPSASAVPADHG
AB014372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB014374_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB014376_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHG
AB014377_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB014378_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPADHG
AB014379_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014380_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014381_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
AB014382_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014383_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
AB014384_HBx_P-C          MAARVCCQLDPARDVLRLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
AB014386_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014387_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGHLSSPSSSAVPANHG
AB014388_HBx_P-C          MAARVRCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
AB014389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
AB014390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHG
AB014391_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGSLPSPPSSAVPAAHG
AB014392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014393_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014394_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014395_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
AB014396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014397_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014398_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB026811_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026815_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB031262_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSPSAVPTDHG
AB033550_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB033551_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAAHG
AB033552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB033553_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB042282_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB042283_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB042284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB042285_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB049610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
AB050018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB074047_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPFGTLPSPSSSAVPADYG
AB074755_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB074756_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
AB104892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AB105173_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB105174_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB106895_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB111114_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111115_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111117_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111118_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB111119_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB111121_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111122_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111124_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111946_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB112063_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHG
AB112065_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
AB112066_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB112348_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
AB112408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
AB112472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
AB113875_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB113877_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSTSAVPADHG
AB113878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAIPTDHG
AB113879_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSAAAVPADHG
AB115417_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSRPFGPLSSPSWSAVPADHG
AB115418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPFGPLSSPSSSAVPADHG
AB117758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
AB176642_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSXSAVPADHG
AB182589_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195930_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
AB195931_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
AB195936_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195942_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195943_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195945_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195946_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195949_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195952_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB195953_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB198076_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVAGPFGPLSSPSSSAVPADHG
AB198077_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB198078_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198079_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB198080_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
AB198081_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198082_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
AB198083_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB202071_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB202072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB205123_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGAIPSPSSSAVPADHG
AB205124_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB205125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
AB222714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB222715_HBx_P-C          HAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB241110_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241111_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241112_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241113_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB246345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB246346_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AB247916_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
AB250109_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
AB288026_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGNLPSPSASAVPADHG
AB298720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300360_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300362_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPLGPLPSPTSSAVPADHG
AB300363_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPADHG
AB300365_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB300368_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB300372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB300373_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307809_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307810_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
AB307811_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
AB307812_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307813_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307815_HBx_P-C          ---RVRCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307816_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307817_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307819_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307820_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307824_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB307825_HBx_P-C          ---RVSCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307827_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB307829_HBx_P-C          ---RVYCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307830_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSAAVPTDHG
AB307831_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
AB307832_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307835_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB307836_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307838_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307841_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
AB307843_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
AB307845_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307846_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
AB307849_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307850_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPLGHLPSPSSSAVPADHG
AB307851_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307852_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPANHG
AB307853_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307854_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307856_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307857_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307858_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB307859_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307862_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307864_HBx_P-C          ---RVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307865_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307866_HBx_P-C          ---RMCCQLDPAPDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307868_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLSSPSASAVPADHG
AB307869_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307870_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB307871_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
AB307872_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307873_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307874_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPANHG
AB307875_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSCSAVPADHG
AB307877_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
AB307880_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
AB307881_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHG
AB307882_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307883_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
AB307884_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307885_HBx_P-C          ---RVCCQLDPARDVLCLRPLGAESRGRPFSGPFGALPSPSSSAVPADHG
AB307887_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307888_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307890_HBx_P-C          ---RVCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLSSPSSSAVPANHG
AB307891_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307892_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSASAVPADHG
AB307893_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSASAVPADHG
AB307896_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307898_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB307899_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AB307901_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307902_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB307903_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307904_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307908_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB307909_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307911_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGTLGHLPSPPCSAVPADHG
AB307913_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307914_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
AB307915_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB307916_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307917_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307919_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
AB307920_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB307921_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307923_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB307925_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPASSAVPADYG
AB307927_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAIPADHG
AB307929_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307930_HBx_P-C          ---RLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB307931_HBx_P-C          ---RMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB307933_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
AB307934_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
AB307935_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307940_HBx_P-C          ---RVCCQLDLARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB307941_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSCSAVPADHG
AB307943_HBx_P-C          ---RVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPANHG
AB307944_HBx_P-C          ---RVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPANHG
AB307946_HBx_P-C          ---RVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPADHG
AB307947_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307948_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB307950_HBx_P-C          ---RMCCQLDLARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AB307951_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPISRPFGPLSSPSASAVPADHG
AB307952_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB307953_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
AB307955_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307957_HBx_P-C          ---RLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB307959_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLPSPSSSAVPADHG
AB307960_HBx_P-C          ---RMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB307962_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AB307963_HBx_P-C          ---RMCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB307964_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB307966_HBx_P-C          ---RVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
AB362932_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB365451_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367392_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367395_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB367396_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSSSAVPADHG
AB367397_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB367398_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367399_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSCSAVPADHG
AB367401_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367402_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB367403_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB367404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB367405_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSPAVPADHG
AB367406_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB367407_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367408_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367409_HBx_P-C          MAARVCCQLDPAGDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
AB367410_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPSDHG
AB367412_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB367413_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367414_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367416_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367418_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367420_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB367421_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
AB367422_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB367424_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367425_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB367426_HBx_P-C          MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHG
AB367427_HBx_P-C          MAARMCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367428_HBx_P-C          MAARVCCQLDPARDVLCLRPIGVESRGRPVSGPFGTLPSPSSPAVPADHG
AB367429_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367430_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPANHG
AB367431_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AB367432_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB367433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
AB367434_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB367435_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367802_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AB367804_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB368297_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGPLSSPSTSAVPADHG
AB471848_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471849_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB485808_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPTDHG
AB493839_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPVAGPLGGLPSPSSSAVPADHG
AB493844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AB640730_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB642095_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB642097_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB642099_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB642100_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670238_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSTSAVPADHG
AB670241_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670242_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670246_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AB670249_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670252_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
AB670254_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670258_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670259_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFEHLPSPSASALPADHG
AB670261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB670262_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSTSAVPADHG
AB670264_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHG
AB670265_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPPSSAVPADHG
AB670266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670268_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670269_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPSSSAVPADHG
AB670272_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670273_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670274_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB670276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670277_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670278_HBx_P-C          MAARMCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLPSPSSSAVPADHG
AB670279_HBx_P-C          MAARVCCQLDPSRDVICLRPVGAESRGRPVSGPFGPLXSPSSSAVPADHG
AB670281_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB670287_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHG
AB670289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670292_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
AB670295_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670297_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB670298_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
AB670301_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB670304_HBx_P-C          MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670305_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPXSGPFGPLPSPSSSAVPADHG
AB670307_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSAAVPTDHG
AB675674_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AB675677_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSPAVPADHG
AB697490_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB697494_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB697500_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AB697502_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB697510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB900099_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSSSAVPADHG
AB900109_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSASAVPADHG
AB900113_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
AB900115_HBx_P-C          MAARLCCQLDPARDVLCLRPVGDESRGRPVAGPFGPLSSPSSAAVPADHG
AB931170_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHG
AB971714_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF068756_HBx_P-C          MAARLCCQLDPARDVLCLRPFGAESRGRPISGPFGALPSPSSSAVPTDHG
AF182802_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AF182803_HBx_P-C          MAARMWCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AF182804_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
AF182805_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AF223954_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223955_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223956_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223957_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF223958_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223959_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223961_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF241410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
AF286594_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AF324347_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF325199_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325701_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF326585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326586_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326590_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF355779_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
AF355785_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AF363961_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF384364_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF384365_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF384372_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
AF411410_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPPDHG
AF411412_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTFPSPSSSAVPADHG
AF458664_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
AF458665_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF461358_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF473543_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF533983_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AJ748098_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHG
AP011097_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPTDHG
AP011098_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AP011099_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AP011100_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHG
AP011101_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGALGDLSSPSPSAVPADHG
AP011106_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AP011107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AY028303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRTFGALPSPSVSAVPANHG
AY028593_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHG
AY057947_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY066028_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPAHHG
AY167090_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY167092_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY167096_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY167099_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
AY206376_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY206378_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY206381_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206382_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY206384_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
AY206386_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAAHG
AY206388_HBx_P-C          MAAGVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
AY206392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY220699_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY220701_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
AY247031_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSTAVPADHG
AY247032_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY251132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTNHG
AY251134_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AY251135_HBx_P-C          MAAMLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
AY251137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY251140_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY251141_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY251142_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY306136_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY308741_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641558_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AY641559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641560_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
AY641562_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AY862869_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
D00630_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D23681_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
D23682_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
D23683_HBx_P-C            MAARMCCQLDPARDVLCLRPVGAESRGRPIPGSFGTLPSPSSSAVPADHG
D23684_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFRSLPSPSSSAVPADHG
D28880_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHG
D50517_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
DQ089756_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089757_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ089758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089759_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089761_HBx_P-C          MAARLCCPLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089762_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPXDHG
DQ089763_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089764_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHG
DQ089765_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
DQ089766_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089767_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVSADHG
DQ089768_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
DQ089771_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
DQ089772_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089775_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
DQ089776_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPTDHG
DQ089777_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSSAVPTDHG
DQ089778_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089779_HBx_P-C          MAARLCCQLDPARDVLXLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089783_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSPSAVPADHG
DQ089784_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPFGTLPSPSSSAVPADHG
DQ089785_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089786_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
DQ089787_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
DQ089788_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089789_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089790_HBx_P-C          MAARLCCQLDXARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
DQ089791_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPADHG
DQ089792_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGSFGTLPSPSSSAVPADHG
DQ089793_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSSSAVPADHG
DQ089794_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
DQ089795_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089796_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
DQ089797_HBx_P-C          MAGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
DQ089799_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089800_HBx_P-C          MAARVCCQLDPARDVLCLRPVDTESCGRPLTGPLGTLPSPSSSAVPAVHG
DQ089801_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
DQ089802_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVPRPFGPLSSPSTSAVPADHG
DQ089803_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089804_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSASAVPTDHG
DQ246215_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ315781_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ315782_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ361534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
DQ377160_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVLADHG
DQ377161_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377162_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377164_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ478885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ478900_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ478901_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
DQ536410_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ683578_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
DQ890381_HBx_P-C          MAAGVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPATHG
DQ922649_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ922650_HBx_P-C          MAARMCCQLDPARDVLCLRPVRSESRGRPVSGPFGTLPSPSSSAVPADHG
DQ922651_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHG
DQ975272_HBx_P-C          MTARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ975273_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ975274_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSFAVPADHG
DQ980547_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ980549_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ980551_HBx_P-C          MAARMCYQLDPARDVLCQRPVGAESRGRPVSGPFGALPSPSYSAVPADHG
DQ986375_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSVGALPSPSSSAVPADHG
DQ986376_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGNLPSPSSSAVPADHG
DQ993181_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
DQ993693_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EF137802_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EF384201_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
EF384205_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
EF494377_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
EF494379_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
EF536065_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EF536066_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPGDHG
EF594748_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSPSAVPTDHG
EF594749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EF594750_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVSTDHG
EF594751_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPFGTVPSPSSSAVPTDHG
EF594752_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPTDHG
EF594753_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EF594758_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594763_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594764_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
EF594766_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAISSPSPSAVPSDHG
EF594767_HBx_P-C          MSARLYCQLDSSRDVLCLRPVGAESRGRPLPRPLGTVSSPSPSAVPSDHG
EF594768_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
EF594769_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
EF688062_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU305540_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU306671_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
EU306672_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
EU306673_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306674_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306675_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306685_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306687_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306690_HBx_P-C          MAARPCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306694_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306713_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPADHG
EU306719_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306722_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306725_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306726_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU306727_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU410079_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
EU410081_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
EU439009_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439010_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439014_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439015_HBx_P-C          MAARVCCHLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439016_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU498227_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU522068_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU522069_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU522071_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSVSAVPANHG
EU547559_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEXSGRPVSGPFGNLPSPSXSAVPADHG
EU547562_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPPSSAVPADHG
EU554535_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSFAVPTDHG
EU554536_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU554537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554538_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU554540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
EU560438_HBx_P-C          MAARVCYQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU560439_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU560440_HBx_P-C          MAARVCCQLDPPRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU562215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562217_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPEPFGPLSSPSSSAVPADHG
EU562218_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
EU570067_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU570068_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
EU570072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU570073_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU579443_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
EU589336_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU589340_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589341_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU670263_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU717212_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU717214_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU717215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGVESRGRPVSGPSGTLPSPSSSAVPANHG
EU717217_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVSADHG
EU717218_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU796069_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
EU871969_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871970_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADRG
EU871971_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
EU871972_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871973_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871974_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871976_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU871978_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871980_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
EU871982_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU872000_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872001_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872002_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
EU872003_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU872013_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
EU881996_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU881999_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU882005_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPANHG
EU916210_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
EU916211_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916214_HBx_P-C          MAARVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916215_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU916216_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU916218_HBx_P-C          MAARVCCQLDPARDVLCLRPISAESRGRPVSGPFGALSSPSSSAVPADHG
EU916219_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU916222_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU916223_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU916224_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU916225_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHR
EU916226_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
EU916227_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916229_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPLSGPFGPLPSPSSSAVPADHG
EU916233_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU916234_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU919168_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
EU919169_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
EU939536_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU939537_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939538_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU939539_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
EU939540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU939541_HBx_P-C          MAARVCCQLDPSRDVLCIRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
EU939542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939543_HBx_P-C          MAGRLCCQMDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
EU939544_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPTDHG
EU939545_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPADHG
EU939546_HBx_P-C          MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSFFAVPANLG
EU939549_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939550_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939553_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
EU939558_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939560_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939563_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939564_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939566_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939567_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939568_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
EU939569_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU939570_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU939571_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
EU939572_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
EU939573_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPADHG
EU939576_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939578_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU939579_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
EU939580_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939582_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPADHG
EU939583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSSSAVPADHG
EU939584_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939585_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939588_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
EU939590_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939592_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939594_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
EU939595_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSVSAVPADHG
EU939596_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
EU939599_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939600_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939601_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
EU939605_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939607_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHG
EU939609_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939611_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
EU939614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939615_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU939616_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSXAVPADHG
EU939617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939618_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHG
EU939619_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
EU939625_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
EU939642_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPIGSLPSPSSSAVPADHG
EU939644_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
EU939645_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
EU939647_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939648_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939649_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
EU939651_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939652_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939653_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSASAVPANHG
EU939654_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939655_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939656_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939657_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939659_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHG
FJ023639_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
FJ023641_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
FJ023642_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDYG
FJ023643_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHG
FJ023645_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023647_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSPSAVPADHG
FJ023648_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSASAVPTDHG
FJ023651_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
FJ023652_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSASAVPTDHG
FJ023654_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023656_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023658_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
FJ032331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ032332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ032334_HBx_P-C          MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032336_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ032339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032340_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ032341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLSSPSSSAVPTDHG
FJ032346_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADLG
FJ032347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
FJ032350_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
FJ032359_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ032360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
FJ349225_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
FJ386575_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
FJ386576_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386577_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386587_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386589_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAEPSGRPVSGPFGPLSSPSSSAVPADHG
FJ386591_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386594_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386595_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
FJ386596_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
FJ386597_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386598_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386601_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386604_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ386605_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPASAVPADHG
FJ386607_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386611_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ386612_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSFSAVPADHG
FJ386613_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386614_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386617_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ386618_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386619_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386620_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
FJ386621_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386623_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
FJ386624_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
FJ386625_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSTSSSAVPADHG
FJ386626_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386627_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPXDHG
FJ386628_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSAPAVPADHG
FJ386629_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
FJ386631_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386632_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386637_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ386638_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSSSSSAVPANHG
FJ386639_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386640_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPADHG
FJ386644_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386645_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386647_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386651_HBx_P-C          MAARVCCQLDPARDVLCLRPVGPESRGRPVPRPFGTLPSPSASAVPADHG
FJ386652_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386653_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386659_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386661_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
FJ386662_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHG
FJ386663_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386664_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPSGTLPSPSPSAVPADHG
FJ386672_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPFSGPFGPLSSPSASAVPANHG
FJ386677_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386678_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPANHG
FJ386679_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ386685_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386687_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
FJ386689_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
FJ562218_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHG
FJ562220_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSASTVPADHG
FJ562221_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562228_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
FJ562232_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562235_HBx_P-C          MAARVCCQLDPARDVLCLRPVVAESRGRPIAGPFGTLPSPSSSAVPADHG
FJ562238_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562239_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ562241_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562243_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562245_HBx_P-C          MAAGVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562248_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
FJ562250_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSSAVPTDDG
FJ562255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ562256_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ562258_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562264_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562265_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
FJ562266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
FJ562268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
FJ562269_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ562272_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562273_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
FJ562274_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562280_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
FJ562282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562285_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
FJ562290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562298_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRTFGPLSSPSASAVPADHG
FJ562299_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
FJ562300_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGGLPSPSLSAVPANHG
FJ562304_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSDSAVPADHG
FJ562307_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGPLSSPSASAVPADHG
FJ562308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
FJ562310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPTDHG
FJ562313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562315_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
FJ562319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSLSAVPADHG
FJ562320_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ562325_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSISAVPADHG
FJ562326_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
FJ562329_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562331_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
FJ562332_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562333_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562335_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAIHG
FJ562337_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ562340_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
FJ751770_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787439_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787441_HBx_P-C          MAARMCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ787445_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787447_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ787449_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHG
FJ787451_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
FJ787452_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ787453_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
FJ787454_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPADHG
FJ787455_HBx_P-C          MAARLCCQLDPARDVLCSRPVGAESRGRPISGPFGALPSPSSSAVPTGHG
FJ787456_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
FJ787457_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ787459_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787461_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787462_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787463_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ787464_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787470_HBx_P-C          MAARVCCQLGPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787471_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787482_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787483_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787485_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787487_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787488_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ787489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787490_HBx_P-C          IATRVCCQLDPARDVLCLRPVGAESRRQSVSGPFGPLPSPSSSAVPADHG
FJ876190_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876191_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876192_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876202_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876203_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876229_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876238_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876239_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876246_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876251_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ899761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899764_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899765_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899768_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ899769_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899772_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
FJ899773_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPLSGPFGTLPSPSSSAVPADHG
FJ899777_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899778_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
FJ899783_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
FJ899788_HBx_P-C          MAARVCCQLDPARDVFCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
FJ899789_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRSVSGPFGALSSPSSSAVPADHG
FJ899793_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ904423_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ184326_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
GQ222210_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
GQ227692_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227693_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ358153_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ358154_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAIPTDHG
GQ358157_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRSVSGPLGVVPSPSPSAVPAAHG
GQ358158_HBx_C-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSRSLGTLPSPSSSAVPADHG
GQ377514_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377517_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
GQ377518_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377524_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
GQ377526_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSAAVPADHG
GQ377527_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPSGSLPSPSSSAVPADHG
GQ377528_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ377529_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGAIPSPSPSAVPADHG
GQ377533_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALPSPSPSAVPADHG
GQ377535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ377536_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377538_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPANHG
GQ377541_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377543_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377545_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
GQ377552_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377555_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
GQ377557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
GQ377559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377562_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
GQ377563_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSLSSSAVPADHG
GQ377572_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ377574_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377575_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAXHG
GQ377576_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ377579_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVAGPFGTLPSPSSSAVPADHG
GQ377580_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSAAAVPADHG
GQ377583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377584_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
GQ377586_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
GQ377599_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377603_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPABHG
GQ377608_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
GQ377609_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377616_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377617_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377618_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSASTSAVPAVHG
GQ377620_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377621_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
GQ377623_HBx_P-C          MAARMCCQLDPARNVLCLRPVDAESRGRSVSGPFGALSSPSSSAVPADHG
GQ377624_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ377628_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377632_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
GQ377636_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHG
GQ475305_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ475306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475307_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475309_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
GQ475311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPTDHG
GQ475315_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475317_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGPLPSPSSSAVPADHG
GQ475318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSAAVPTDHG
GQ475322_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPAVHG
GQ475325_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ475326_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475330_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
GQ475331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ475333_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ475337_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475338_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSTVPADHG
GQ475339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSFSAVPADHG
GQ475341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475342_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475343_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSAAVPADHG
GQ475344_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475345_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475347_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475348_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475349_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475350_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSTAVPADHG
GQ475353_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475355_HBx_P-C          MAARVCCQLDPXRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475356_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ475357_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHG
GQ855521_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
GQ855523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPPDHG
GQ855525_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
GQ855528_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSFAVPTDHG
GQ855530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
GQ855531_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSAVPTDHG
GQ855534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ855537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ855541_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPPDHG
GQ855543_HBx_P-C          MAARLYCQLDPARDVLCLRPLDAESRGRPVSGPFGALPSPSSSAVPADHG
GQ855544_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLPSPSSSAVPTDHG
GQ855548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
GQ855596_HBx_P-C          MAARLCCQLDPARDVLCLRPLRAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ924604_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GQ924609_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
GQ924612_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
GQ924613_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
GQ924614_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924615_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ924616_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ924619_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ924620_HBx_C-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
GQ924622_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPADHG
GQ924623_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAFPADHG
GQ924633_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ924636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924642_HBx_P-C          MAARLCCQLDPARDVLCLRPVRAESRGRPISGPFGTLPSPASSAVPADHG
GQ924643_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPADHG
GQ924650_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ924655_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSASAVPADHG
GQ924658_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GU357845_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GU434374_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
GU563561_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPTDHG
GU721029_HBx_P-C          MAARVCCQLDPTRNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
HM011472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
HM011479_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
HM011481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
HM011486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSPSAVPADHG
HM011489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
HM011491_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
HM011493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGDESCGRPVPGPFGNLPSPSLSAVPADHG
HM011495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
HM011497_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
HM011500_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750131_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPISGPFGSLPSPPSSALPADHG
HM750132_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750134_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750136_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGAFGDLPSPSSSAVPADHG
HM750137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
HM750140_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM750141_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPADHG
HQ622095_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGSLSSPSTAAVPADHG
HQ700456_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPATHG
HQ700457_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGXLXSPSSSAVPANHG
HQ700475_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPAXHG
HQ700476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HQ700490_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700495_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700496_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700502_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
HQ700504_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700506_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGALPSPPSSAVPADHG
HQ700516_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDLSSPSSSAVPTDHG
HQ700517_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTVPSPSSSAVPTDHG
HQ700522_HBx_P-C          MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
HQ700529_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPLGDLPSPSPSAVPADHG
HQ700555_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700556_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSFAVPANHG
HQ700558_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700559_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLPSPSPSAVPANHG
HQ700562_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700563_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGGLSSPSSSAVPANHG
HQ700564_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700565_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700566_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGTLPSPSPSAVPANHG
HQ700567_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700568_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700569_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPFAVPANHG
HQ700570_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700571_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
HQ700572_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700574_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
HQ700575_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLSSPSPSAVPANHG
HQ700576_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDXPSPSXSAVPANHG
HQ700577_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLXSPSXXAVPANHG
HQ700578_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGTLPSPSPSAVPANHG
JF436920_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JF828905_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828906_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828908_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
JF828910_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828913_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828915_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828916_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828921_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSFGPLPSPSSSAVPADHG
JF828922_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828925_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESCGRPLSGPFGPLPSPSSSAVPADHG
JF828937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF899336_HBx_P-C          MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104432_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
JN104433_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
JN104434_HBx_P-C          MAAWVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHR
JN104435_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN104437_HBx_P-C          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN104440_HBx_P-C          VAARLCCKLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSSSTVPADHG
JN418493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
JN418495_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
JN418496_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418497_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
JN418498_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
JN418500_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JN418503_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418504_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418505_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
JN418506_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
JN418508_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPVGPLSSPSSSAVPADHG
JN418509_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
JN418510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
JN418511_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418512_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418513_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
JN418514_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVTGPFGSLPSPSSSAVPADHG
JN418518_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JN418523_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418524_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418525_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGPIPSPSSSAVPADHG
JN418526_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418527_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPPDHG
JN418530_HBx_P-C          MAARLCCQLDPARDVLCLRPVGTESRGRPVSGPFGPLPSPSSSAVPADHG
JN418532_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418533_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418534_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
JN418535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418536_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418538_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418539_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
JN418540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
JN418541_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
JN418542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
JN418543_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418544_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418546_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPANHG
JN418550_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418552_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418554_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
JN418555_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418556_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
JN418558_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418560_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418564_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418565_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
JN574721_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
JN574724_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827414_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALSSPSPSAVPADHG
JN827415_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHG
JN827417_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JN827418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JN827420_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ027317_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPXSGPFGTLSSPSSSAVPADHG
JQ027318_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JQ027319_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ027320_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPFGTLPSPSSSAVPADHG
JQ027321_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027322_HBx_P-C          MAARXCCQLDTARDVLCLRPVGAESRGRPVAGPSGALPSPSSSAVPADHG
JQ027323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ027324_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPTDHG
JQ027332_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
JQ040129_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040131_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040133_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPSGTLPSPSSSAVPTDHG
JQ040139_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040141_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040143_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
JQ040144_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JQ040145_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040149_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLXSPSSSXVPADHG
JQ040151_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSXVPADHG
JQ040152_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESGGRPVSGPFGSLPSASSSAVPADHG
JQ040162_HBx_P-C          MAARMCCQLDPARDVLSLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040163_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040164_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040165_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JQ040166_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPSPSSSAVPADHG
JQ040167_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040168_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040172_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341859_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
JQ341863_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
JQ341865_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
JQ341868_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341870_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341875_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
JQ341877_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341878_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLXSPSXSAVPADHG
JQ341879_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341883_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341885_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
JQ341886_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JQ341887_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPADHG
JQ341889_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JQ341890_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JQ341891_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341892_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ341893_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGXLPSPSSSAVPTDHG
JQ341895_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341896_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAVPADHG
JQ341899_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPVGTLPSPSSSAVPTDHG
JQ341900_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341902_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ429078_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
JQ518364_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JQ707707_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707708_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707711_HBx_P-C          MAARMCCKLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707715_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707730_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707733_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707768_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707773_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPTDHG
JQ801472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSASAVPTDHG
JQ801473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801481_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSSSAVPTDHG
JQ801482_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801483_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
JQ801488_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
JQ801489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801490_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
JQ801491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPIGTLPSPSASAVPPDHG
JQ801493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPTASAVPTDHG
JQ801495_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ801497_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPTDHG
JQ801498_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLPSTSSSAVPADHG
JQ801499_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801500_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ801501_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ801502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
JQ801504_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGALPSPSSSAVPADHG
JQ801505_HBx_P-C          MAARLCCQLDPTRNVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ801509_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
JQ801510_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSPSAVPTDHG
JQ801511_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ801513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSTSAVPTDHG
JQ801515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JQ801518_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801521_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801522_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801523_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
JX026877_HBx_P-C          MAARVYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026878_HBx_P-C          MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGGIPSPASSAVPADHG
JX026880_HBx_P-C          IAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026884_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
JX026888_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPADHG
JX429903_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLETLPSPSSSAVPADHG
JX429904_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429905_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSTVPTDHG
JX429906_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429907_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPFGTLPSPSSSAVPADHG
JX429909_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
JX429912_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSSSSSAIPADHG
JX429913_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JX429914_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPADNG
JX429915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429916_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
JX429917_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX429918_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSYSAVPTDHG
JX504534_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX504535_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX504537_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
JX504541_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
JX504542_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX504544_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX504545_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
JX507211_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPTDHG
JX507212_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX507214_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX560519_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
JX560520_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
JX661488_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX661490_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661491_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661492_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX661493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
JX661495_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSPSAVPADHG
JX661496_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661497_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX870000_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC163865_HBx_P-C          MAARMCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163866_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVLGPFGTLPSPSSSAVPADHG
KC163867_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPIGTLPSPSSSAVPTDHG
KC163868_HBx_P-C          MAARMCCQLDPARDVLCLRPVSPESRGRPVSGPFGTLPSPSSSAVPADHG
KC163869_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163871_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163872_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163873_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPAAHG
KC163874_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163875_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADYG
KC163879_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163880_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163881_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFRTLPSPSSSAVPADHG
KC163883_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163884_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163886_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163887_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163889_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHG
KC163890_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPPPSSSAVPADHG
KC163892_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163895_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163904_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163905_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
KC163906_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
KC163940_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
KC163947_HBx_P-C          MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC163948_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163949_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163950_HBx_P-C          MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC163952_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163954_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGTLPSPSSSAVPADHG
KC163955_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163956_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163957_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163958_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163959_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163961_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163962_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163965_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163970_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163971_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163981_HBx_P-C          MAARVCCRMDPARDVLCLRPVGAESRGRPVAGPFGTPSSPSSSAVPADNG
KC163982_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163983_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPANNG
KC163985_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163987_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163988_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163993_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163994_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVAGPFGTPPSPSSSAVPADNG
KC163996_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164036_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164037_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164038_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164041_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164080_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164081_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164083_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164086_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSTSSSAVPADHG
KC164089_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164120_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164121_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164122_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164123_HBx_P-C          MAAGLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164125_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164126_HBx_P-C          MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVRADHG
KC315399_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KC774179_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774180_HBx_P-C          MVPRVCGQLDPARDVRCLRPVGPESRGPPVSRPLGPLWSPFSFAVPANRG
KC774181_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGSFGSLPSPSASAVPADHG
KC774184_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSTVPADHG
KC774185_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
KC774187_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPANHG
KC774189_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPFGDLPSPSSSAVPADHG
KC774191_HBx_P-C          MDDRVCCQLDPARDVLCLRPVGVESRGRPVSGPFGAFPSPSSFAVPADHG
KC774192_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KC774194_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC774195_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGTFGTLPSSSSSAVPADHG
KC774196_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC774197_HBx_P-C          MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPCGALPSPCSSAVPADRG
KC774199_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTPSAVPTNHG
KC774200_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPTLFAVPADHG
KC774202_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774203_HBx_P-C          MDVRVCCQVDRARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
KC774204_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774205_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774206_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774207_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774210_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774211_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
KC774213_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774214_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774215_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC774216_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC774217_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
KC774218_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KC774219_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774220_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSTVPADHG
KC774221_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774223_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774224_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774225_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
KC774226_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KC774227_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFLFAVPTDHG
KC774229_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSSSAVPADHG
KC774231_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774232_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KC774235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGALPSPSLSAVPADNG
KC774236_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
KC774237_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC774238_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774241_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774242_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRSFSGPFGALSSPSSSAVPADHG
KC774244_HBx_P-C          MVARVCCQVDHARDVLSLRPVGAESRGRPISGPFGTLRSHCSFAVPADHG
KC774245_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774247_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KC774248_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774249_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KC774250_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774251_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774252_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774253_HBx_P-C          MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774254_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774256_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774257_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774260_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
KC774261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSLSAVPADHG
KC774262_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSSSAVPADHG
KC774264_HBx_P-C          MDARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALRSPSSFAVPADHG
KC774265_HBx_P-C          MAARMCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSFAVPADHG
KC774268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAIPADHG
KC774269_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774270_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774271_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPTDHG
KC774272_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774274_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPTDHG
KC774276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAIPADHG
KC774277_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
KC774279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSPAVPANHG
KC774281_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774283_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC774284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
KC774286_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPANHG
KC774288_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774292_HBx_P-C          MDARLCSQLDPARAILYLRPVGAESRGRPVSGQFGPLPSLFASAVPANHG
KC774295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPADHG
KC774296_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774298_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KC774299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPADHG
KC774300_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAYG
KC774301_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPANHG
KC774303_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
KC774306_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLPSPSPSAVPADHG
KC774308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSDSAVPADHG
KC774311_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSLTSSAVPADHG
KC774312_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774316_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPANHG
KC774318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
KC774320_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774321_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSPSAVPADHG
KC774325_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774326_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC774327_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAIPADHG
KC774329_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVSSPSSSAVPADHG
KC774330_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPAAHG
KC774333_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774334_HBx_P-C          MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774335_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPIGDLPSPSTSAVPAEHG
KC774336_HBx_P-C          MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC774337_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774339_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774340_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774342_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774343_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KC774345_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
KC774348_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHG
KC774351_HBx_P-C          MAGPMGSRPEPPRGRPCIRRIGGETRGGPVSGPSGPFPSRCPCGAPGAPG
KC774352_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774353_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KC774354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774356_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774357_HBx_P-C          MAVRGCCQLDPARDVLGLRPVGVESRGRPVSGPFGHLPSLSSSAVPADHG
KC774359_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814854_HBx_P-C          KAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814855_HBx_P-C          MAVRVCCQLDLARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814857_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814862_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814863_HBx_P-C          MAARLCCQLGLARDVLCLRPVGAESRGRPVSGPFGLLPSPSSSAVPADHG
KC814865_HBx_P-C          LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814866_HBx_P-C          MAARVCCQLDSMREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814871_HBx_P-C          KAARVCCQLNSAGDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814877_HBx_P-C          MAARVCCQLTEAGDVLCLRPVGAESRGRPVSGPVGTLPSPSSSAVPADHG
KC814879_HBx_P-C          MAARVCCQLDPARDILCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814880_HBx_P-C          FAARVCCQLDDAEDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814881_HBx_P-C          LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814882_HBx_P-C          MAARVCCQLVLMPFVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814884_HBx_P-C          MAARVCCQLSLTPEVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814887_HBx_P-C          MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814888_HBx_P-C          IGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KC814889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KC814892_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814896_HBx_P-C          WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814897_HBx_P-C          LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814898_HBx_P-C          KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814899_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814900_HBx_P-C          MAARVCCQLDDARDVVCLRAVGAESRGRPVSGPFGTLPSPSSSAVPADQG
KC814901_HBx_P-C          MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814902_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814903_HBx_P-C          MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814904_HBx_P-C          KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814905_HBx_P-C          MAARVCCQLDDAREVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814906_HBx_P-C          LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814907_HBx_P-C          MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814908_HBx_P-C          WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814909_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814911_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814912_HBx_P-C          MAARVCCQLDPARECLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814913_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC814914_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814916_HBx_P-C          MAARVCCQLGPAEYVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESCGRPISGPFGTLPSPFSSAVPPDHG
KC814920_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KC814922_HBx_P-C          MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHG
KC875261_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875262_HBx_P-C          MAARVCCQLDPAGDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875264_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875265_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875269_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875272_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875273_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF214651_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KF214652_HBx_P-C          MAARVYCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KF214655_HBx_P-C          MAARVYCQLDPPRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KF214667_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KF214668_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLQGPLGTLPSPSPSAVPTDHG
KF214670_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KF214671_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KF214672_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KF214673_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KF214675_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KF214676_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
KF214677_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KF485389_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
KF485390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KF495606_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KF873514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAEPRGRPFSGPLGALPSPSSSAVPADHG
KF873516_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873520_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873525_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGXXPSPSPSAVPADHG
KF873526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873528_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873529_HBx_P-C          MAAXLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873536_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873539_HBx_P-C          MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873541_HBx_P-C          MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGXLPSPSSSAVPADHG
KF873544_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KJ173281_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173283_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173285_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173286_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173287_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173288_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173289_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173290_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173292_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173293_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173304_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173305_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHG
KJ173307_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173308_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173309_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173310_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173311_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173317_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KJ173318_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KJ173319_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173327_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173328_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173331_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173334_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173335_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
KJ173337_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173393_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173395_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173427_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173431_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173432_HBx_P-C          MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ173439_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ173443_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173446_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
KJ410489_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410491_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410492_HBx_P-C          MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410493_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KJ410496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGSLPSPSSSAVPADHG
KJ410498_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ410499_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ410504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410505_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAGHG
KJ410508_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPAVNG
KJ410510_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
KJ410513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410515_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
KJ410518_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410521_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
KJ598635_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598636_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598637_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598639_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598641_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598642_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598645_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598654_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHG
KJ598655_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598658_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598661_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASSAVPADHG
KJ598662_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598663_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598667_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598670_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598672_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598674_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPSGALPSPSLSAVPAAHG
KJ598677_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSLSAVPAAHG
KJ598678_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSHSLSAVPAAHG
KJ598681_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598687_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598689_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSTTAVPADHG
KJ598693_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598694_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598705_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598711_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598715_HBx_P-C          MAARVRCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598718_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSLSAVPADHG
KJ598720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KJ598721_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598722_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598723_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598724_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598725_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598727_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
KJ598728_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598730_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPIGALPSPSVSAVPPDHG
KJ598731_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598733_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598734_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSVSAVPADHG
KJ598736_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KJ598738_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598740_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598741_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598742_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598743_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598746_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ598747_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ598748_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598754_HBx_P-C          MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPAAHG
KJ598756_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHR
KJ598761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598762_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
KJ598766_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598767_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598768_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598770_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
KJ598778_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ803754_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAISADHG
KJ803757_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPSDHG
KJ803759_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ803760_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPTDHG
KJ803761_HBx_P-C          MAARLCCQLDPARDVLWLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ803762_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803765_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803766_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHG
KJ803769_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ803770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPFGTLPSPSSSAVPADHG
KJ803774_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSTVPAAHG
KJ803776_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KJ803777_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KJ803779_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803780_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ803790_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPADHG
KJ803792_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803793_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
KJ803794_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803799_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPFGTLPSPSSSAVPTDHG
KJ803800_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803809_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRSVSRPLGSLSSPSASAVPADHG
KJ803810_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGSLPSPSSSAVPADHG
KJ803811_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803815_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803818_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803823_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
KJ997796_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997811_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997815_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFETLPSPSPSAVPTDHG
KJ997856_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ997866_HBx_P-C          MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ997875_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ997876_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KM213037_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM359441_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KM875404_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KM875406_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM875412_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
KM875423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
KM875424_HBx_P-C          MAARLCCQLDPTRNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KM875428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KM875430_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHG
KP148463_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148465_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148466_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148470_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148471_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148472_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148473_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148480_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148483_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148487_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148512_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148513_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148525_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148532_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148538_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148545_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148547_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148548_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148551_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148555_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148560_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KP148566_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148568_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148570_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148573_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148575_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP784761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013761_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013763_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013764_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013765_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013770_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013771_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013772_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013774_HBx_P-C          MAAGACCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013776_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013778_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLLSPSSSAVPADHG
KR013779_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013780_HBx_P-C          MAARVCCQLNPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013786_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013788_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013789_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013791_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
KR013792_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPATHG
KR013794_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KR013795_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KR013796_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KR013797_HBx_P-C          MAARVCCRLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013800_HBx_P-C          MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAGHG
KR013804_HBx_P-C          IAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013805_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013809_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013810_HBx_P-C          MAARVCCQLDPARNVLCLRHVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013811_HBx_P-C          MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013812_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFGTLPSPSSSAVPADHG
KR013815_HBx_P-C          MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFETLPSPSSSAVPADHG
KR013818_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTIPSPSPSAVPADHG
KR013819_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KR013820_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESHGRPVSGPFGTLPSPSSSAVPADHG
KR013822_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013823_HBx_P-C          MAARLCCQLDPARDVLCLRPAGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013824_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013826_HBx_P-C          MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013828_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013829_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAAPADHG
KR013831_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013835_HBx_P-C          TAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013836_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013837_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013839_HBx_P-C          MAVRLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013841_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013842_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013844_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAIPADHG
KR013845_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPFPSSSAVPADHG
KR013846_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013848_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013849_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013852_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013855_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013856_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013857_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013858_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013859_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013861_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013862_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAAHG
KR013863_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013864_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013865_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013866_HBx_P-C          MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013868_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013869_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR013870_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR013873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSSAVPADHG
KR013877_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013882_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPAAHG
KR013890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013903_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013915_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGQPVSGSLGTLPSPSSSAVPADHG
KR013919_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSSSAVPANHG
KR013923_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013927_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013942_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
KR013975_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADHG
KR014002_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014005_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014006_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014007_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014008_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014010_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014011_HBx_P-C          MAARACCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014013_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPATHG
KR014017_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014018_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014021_HBx_P-C          MTARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR014041_HBx_P-C          MAARVCCQLDPVRDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR014043_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014055_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014059_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014082_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR014083_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR811459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811467_HBx_P-C          MDARLCCQLBPARDVLCLRPFGAESRGRPISGPFGNLPSPSSSAXPTDHG
KR811476_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRSVSGPLGDLPSPSSSAGPADHG
KR811501_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR811522_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPTDHG
KR811524_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR811534_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811578_HBx_P-C          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
KR811636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR811644_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
KR811654_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGSFGALPSPSSSAVPTDHG
KR811722_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADLG
KR811723_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADLG
KR811725_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811726_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811728_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADLG
KR811729_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811730_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811732_HBx_P-C          MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811733_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR811736_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR811740_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811742_HBx_P-C          MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811745_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811747_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFSSAVPADHG
KR811749_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811751_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811752_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811755_HBx_P-C          MAAMLCCQLDPARDILCLCLVGAESRGRPVSGPLGTLPSPSPSAVPVDHG
KR811756_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811758_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811763_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811882_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR811886_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KR811889_HBx_P-C          MAARLCCQLDPTRDILCLRPVGAESRGRPLSGPLGTLSSPSPSAVPVDHG
KR811913_HBx_P-C          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
KR811950_HBx_P-C          MAAGLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KR812078_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KR812086_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KR812088_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KR819180_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
KT235617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVSTDHG
KT235618_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
KT235627_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTIPSPSPSAVPSDHG
KT284753_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFRALPSPSSSAVPADHG
KT284755_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KT284756_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVEGPFGTLPSPSSSAVPADHG
KT284758_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRPLSSPSSSAVPADHG
KT307718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT364718_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPVGTLPSPSASAVPTDHG
KT364719_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT364721_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KT364751_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSPSAVPADHG
KT364752_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KT366464_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPTDHG
KT987423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
KT987425_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
KT987426_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KU051423_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPTDHG
KU051424_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTAHG
KU051426_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051427_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KU679936_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU679937_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDXPSPSSSAVPAXHG
KU679947_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KU679949_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESRGRPFSGPLGALPSPSSSAVPADHG
KU679951_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLXSPSPXAVPADHG
KU679957_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KU679960_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPPGDLPSPSSSTVPADHG
KU963874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963886_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963887_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRHVSGPFGTLPSPSSSAVPADHG
KU963893_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPANHG
KU963894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963900_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963915_HBx_P-C          MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963937_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963992_HBx_P-C          MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964004_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGNLPSPSSSAVPADHG
KU964011_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KU964012_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964014_HBx_P-C          MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964015_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
KU964016_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KU964019_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964020_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964028_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964034_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964035_HBx_P-C          MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964049_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964064_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964065_HBx_P-C          MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964076_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964169_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964172_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964173_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHE
KU964176_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRRRPFSGPFGALPSPSSSAVPADHG
KU964179_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964185_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964189_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964200_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964214_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPISSPSSSAVPADHG
KU964215_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964216_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964219_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964225_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964318_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964321_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964322_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964352_HBx_P-C          MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964360_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276831_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276833_HBx_P-C          MAARLCCQLDPARNVLCLRPVGAESXGRPVSRPFGPLSSPSASAVPADHG
KX276835_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPANHG
KX276836_HBx_P-C          MAARLXCQLDPARDVLCLRPVGXESRGRPVSRPFGTLSSPSASAVPADHG
KX276837_HBx_P-C          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KX276838_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276839_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX276840_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KX276841_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KX276844_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPASSAVPADHG
KX276846_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KX276847_HBx_P-C          MAARLCCQLDPARDXLCLRPVGAESRGRPXSGPFGXLPSPSSSAVPTDHG
KX276848_HBx_P-C          MAARLCCQLDPARBVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KX276849_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGXLPSSSSXAVPTDHG
KX276850_HBx_P-C          MAARLCCQLDPARDVLCLRPVXAESSGRPXSGPFGALPSPSSSAVPTDHG
KX276852_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESXGRPVSGPFGTLPSPSSSAVPADHG
KX276853_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276854_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSPAVPADHG
KX276855_HBx_P-C          MAARLYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KX429617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSSAVPADHG
KX429625_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
KX765819_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPTDHG
KX765820_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
KX765821_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KX765822_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KX765823_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KX765825_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
KX765826_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSASAVPTDHG
KX765827_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESCGRPISGPFGTLPSPSSSAVPADHG
KX765828_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KX765830_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KX765832_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KX765834_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGTLPSPSSSAVPTDHG
KX765837_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSASAVPPVHG
KX765838_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGALPSPSASAVPPNHG
KX765842_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765843_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLSSPSSSAVPTDHG
KX765844_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765845_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KX765849_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPPASAVPTDHG
KX765851_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAKSRGRPLSRPFGTLPSPSSSTVPTDHG
KX765852_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
KX765853_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765855_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFRSLPSPSSSAVPTDHG
KY022423_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
KY363252_HBx_P-C          MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363254_HBx_P-C          MAARVCCQLDPVRGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPVNHG
KY363257_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGPLPSPSCSAVPADHG
KY363258_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
KY363260_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363264_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAIHG
KY363266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363267_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363274_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSVAVPADHG
KY363277_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSAAVPADHG
KY363278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPFPGPFGPLPSPSTSAVPADHG
KY363280_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY363281_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363282_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363283_HBx_P-C          MATRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363284_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
KY363286_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KY470873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLLSPSSSAVPADHG
KY470874_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470883_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470885_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470887_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470895_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470911_HBx_P-C          MAARLCCQLDPAQDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470913_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSDVPADHG
KY470914_HBx_P-C          MAARLCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY470915_HBx_P-C          MAARLCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470916_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY470917_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470925_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470926_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470927_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFESLPSPSSSAVPADHG
KY470929_HBx_P-C          MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KY470934_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470936_HBx_P-C          MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KY470937_HBx_P-C          MAARPCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KY470965_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470966_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470967_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPPPSSAAVPTDHG
KY470968_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470977_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPTDHG
KY470980_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470983_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470985_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY629631_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGGLPSPSLSAVPADHG
KY670782_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGGLPSPSLSAVPTDHG
KY881736_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881802_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881803_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881805_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881806_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881807_HBx_P-C          MAARVCCQPDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881809_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881810_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881811_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881812_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881813_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPLSGPLGTLPSPSSSAVPADHG
KY881814_HBx_P-C          MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881816_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLPSSSSSAVPADYG
KY881817_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVAGPLGTLPSPSSSAVPADHG
KY881818_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881819_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KY881871_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881872_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881873_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881876_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881877_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881878_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KY881879_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881880_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881881_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881882_HBx_P-C          MAARVCCQLGPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881883_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881891_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881915_HBx_P-C          MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881917_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881919_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881923_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881930_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881937_HBx_P-C          MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881959_HBx_P-C          MAARVCCQLDPARNVLCLRPVNTESRERPVSGPFGTLPSPSSSAVPANHG
KY881961_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881962_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881967_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANRG
KY881968_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881972_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KY881979_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881987_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881988_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881993_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADRG
KY881996_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881997_HBx_P-C          MAARVCCQLDPARYVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY882000_HBx_P-C          MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAIPANHG
LC279245_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
LC279246_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279250_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279252_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279253_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279254_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279258_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
LC279259_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279274_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279276_HBx_P-C          MAARLCYQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC318703_HBx_P-C          MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSSSAVPANHG
LC730886_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPADHG
MF059475_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF059652_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPRPFGALSPPSSSAVPADHG
MF059688_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MF115871_HBx_P-C          MAARLCCQLDPARDVPCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MF115873_HBx_P-C          MAGGLCCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MF115897_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
MF115898_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
MF488701_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGSLPSPSSSAVPTDHG
MF488703_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MF674386_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674388_HBx_P-C          MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674390_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674402_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674403_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MF674408_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
MF674411_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674412_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MF674418_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674425_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674428_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674429_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674430_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MF674435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674442_HBx_P-C          MAARLCCQLDPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674457_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLPSPSSSAVPADHG
MF674468_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674471_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674474_HBx_P-C          MAARLCCQLDPARDVVCLRPVSAESSGRPISGPFGPLPSPSSSAVPTDHG
MF674475_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674484_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674494_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674501_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674502_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674504_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674514_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MF925359_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF925365_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925367_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSPSSSAVPADHG
MF925369_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925375_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF925376_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPSDHG
MF925377_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGALPSPSSSAVPTDHG
MF925378_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTLPSPSSSAVPTDHG
MF925394_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPTDHG
MF925395_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
MF925403_HBx_P-C          MAARLFCQLDSARDVLCLRPVGAESCGRPLSGPIGDLPSSSSSAVPTVHG
MF925406_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925409_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPSDHG
MF925410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MG571332_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
MG571335_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MG571345_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
MG571359_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
MG725248_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MG826122_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MG826123_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
MG826124_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTVPSPSSSAVPADHG
MG826125_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MG826126_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSVSAVPADHG
MG826128_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MG826129_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MG826131_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG826132_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826133_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826134_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826135_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
MG826136_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MG826137_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826138_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVSADHG
MG826139_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826140_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MG826143_HBx_P-C          MVARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
MG893553_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893556_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893557_HBx_P-C          MAARVCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893558_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MG893560_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
MH094411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MH220971_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPTDHG
MH488809_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPANHG
MH488810_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPANHG
MH488821_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MH488822_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488831_HBx_P-C          MAARTCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
MH488838_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488839_HBx_P-C          MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSVVPADHG
MH488850_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MH488859_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MH887433_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MH891502_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171258_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171260_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MK171261_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171262_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171263_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
MK171264_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171265_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
MK171267_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAIPTDHG
MK171268_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171271_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171275_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MK171276_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171278_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171279_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
MK171281_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171282_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171289_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171291_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171295_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
MK171297_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171298_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171299_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171300_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSFSAVPADHG
MK171301_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171302_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171303_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171312_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHG
MK171313_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGPLSSPSASAVPADHG
MK171314_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
MK171315_HBx_P-C          MAARLYCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
MK171316_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHR
MK171317_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171318_HBx_P-C          MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPANHG
MK171319_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAEPSGRPVSGPFGTLPSPSSSAVPADHG
MK171320_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPTSSAVPADHG
MK171322_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHG
MK171323_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171324_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171325_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPLGTLSSPSASAVPADHG
MK171326_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171327_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171328_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171329_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAXHG
MK171330_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171338_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHG
MK171339_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPXXXPFGPLSSPSASAVPADHG
MK171340_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171341_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSASAVPADHG
MK171344_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171345_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPANHG
MK171347_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171348_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171350_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPSSAVPADHG
MK171351_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPANHG
MK171352_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
MK171353_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171354_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171355_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171358_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171360_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171361_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
MK171363_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171379_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MK171382_HBx_P-C          MAARVCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSTSAVPADHG
MK171384_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171388_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
MK171389_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPSGGLPSPSSSAVPADHG
MK171391_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171392_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171393_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSSVPADHG
MK171394_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171399_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MK171401_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
MK171402_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171404_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171405_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADNG
MK171408_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171410_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171411_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171412_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171415_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
MK171423_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171425_HBx_P-C          MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171428_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171429_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSTSSSAVPADHG
MK171430_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171432_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MK171434_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171435_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171436_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSLSAVPADHG
MK171438_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171439_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171440_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK171442_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171444_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171446_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171447_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
MK171449_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171450_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171451_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
MK171452_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVPGPFGDLPSPSFSAVPADHG
MK171453_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSRPLGALPSPSPSAVPADHG
MK171454_HBx_P-C          MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171457_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171459_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVXGPLGDLPXPSSPAVPXDHG
MK171462_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171463_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
MK171464_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171465_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHG
MK171470_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
MK171471_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSATAVPANHG
MK171472_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171473_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171477_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSSSSSAVPADHG
MK171479_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171480_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPTDHG
MK171483_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171484_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSXPFGTLPSPSSSAVPADHG
MK171485_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171488_HBx_P-C          MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPANHG
MK171489_HBx_P-C          MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGSLPSPSASAVPADHG
MK171493_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSLSAVPADHG
MK171494_HBx_P-C          MAARMCCQLDTARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAVNG
MK171496_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPADHG
MK171500_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANNG
MK171504_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171505_HBx_P-C          MAARXCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSSSAVPADHG
MK171506_HBx_P-C          MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171508_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPABHG
MK171510_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSTSAVPADHG
MK171512_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171513_HBx_P-C          MAARVCCQLDPARDVLCLRPVGPESRGRPVARPLGTLPSPSVSAVPADHG
MK171517_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLPSPSSSAVPAAHG
MK171519_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRSVPGPFGDLPSPSLSAVPADHG
MK171520_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALSSPSSSAVPADHG
MK171522_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
MK171524_HBx_P-C          MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSASAVPADHG
MK171526_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MK171529_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171531_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVARPFGALPSPSPSAVPADHG
MK171533_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MK171534_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGPLPSPSSSAVPAVNG
MK171535_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSASAVPADHG
MK171537_HBx_P-C          MAARLCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHG
MK171539_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171540_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSXSAVPADHG
MK171543_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171549_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
MK171550_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171553_HBx_P-C          MAARVCCQLDPARDVLCLRPLGNESRGRPVSGPFGTLPSPSESAVPADHG
MK171554_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171557_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MK171559_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSPSAVPADHG
MK171561_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MK171564_HBx_P-C          MAARMCCQLDTARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171574_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
MK171575_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171580_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLPSPSSSAVPADHG
MK171581_HBx_P-C          MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171582_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171583_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171584_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
MK171585_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSASAVPTDHG
MK171586_HBx_P-C          MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MK171590_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHHG
MK171600_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171602_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSPPSSSAVPADHG
MK171609_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
MK171610_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK171611_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MK171612_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAHHG
MK171615_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
MK171616_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171619_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPSGTLPSPSSSAVPADHG
MK171620_HBx_P-C          MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171621_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171622_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAIPTDHG
MK171623_HBx_P-C          MAARVCCQLDPARDVLCLRPVDAESRGRPVSRPFGTLPSPSPSAVPADHG
MK171624_HBx_P-C          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171625_HBx_P-C          MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK171627_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171628_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171629_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MK171630_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK171633_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171635_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHG
MK171637_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGTFGSLPSPSSSAVPAAHG
MK171640_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171641_HBx_P-C          MAARVCCQLDLARDVLCLRPVSAESRGRPVSGPFEPLPSPSSSAVPADHG
MK171645_HBx_P-C          MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK171646_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPVGGLSSPSSSAVPADHG
MK171647_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MK171648_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MK321266_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLXSPXSSAVPADHG
MK534557_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MK534593_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK534604_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPADHG
MK534605_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPADHG
MK534619_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
MK534636_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MK534638_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHG
MK534642_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
MK534643_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534644_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
MK534649_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MK534657_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLPSPAASAVPPDHG
MK534671_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSPAVPTDHG
MK534674_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHG
MK534677_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLTGALGALPSPSPSAVPADHG
MK534678_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK534720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPADHG
MK628732_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MK720629_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPPSSAVPADHG
MK818227_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MN066399_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MN683726_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MN683728_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
MN683729_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSFAVPADHG
MT114171_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
MT426105_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
MT426107_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MT426109_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MT644995_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
MT644996_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDVSSPSPSAVPADHG
MT644997_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGSLGGLSSPSPSAVPADHG
MT644998_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT644999_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645000_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MT645003_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPTSSAVSTDHG
MT645004_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
MT645007_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPADHG
MT645008_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSPSAVSADHG
MT645009_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDISSPSPSAVPADHG
MT645010_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPADHG
MT645011_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPTDHG
MT645012_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
MT645013_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALSSPSPSAVSADHG
MT645014_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MT645017_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645019_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645020_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645021_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MT645022_HBx_P-C          MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MT645023_HBx_P-C          MAARLCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MT645024_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MT645027_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
MT645028_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
MT645030_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MT645032_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
MT645037_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MT645040_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645043_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGSFGSLSSPSSSAVPADHG
MT645046_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
MT645047_HBx_P-C          MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSSSAVPADHG
MT645050_HBx_P-C          MAARMCCQLDPTRDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645051_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGNLSSPSSSAVPADHG
MT645053_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSTSSAVPADHG
MT645054_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MT645055_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MT645059_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
MT645072_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
MW310259_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
MW310260_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSSSAVPANHG
MW675885_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSSSTVPTDHG
MW675886_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTVPSPSSSAVPTDHG
MW675887_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSPSAVPTDHG
MW675888_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
MW675889_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPSSSAVPANHG
MW675890_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSSSAVPANHG
MW675892_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
MW675893_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MW675894_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MW675896_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPLGVVPSPSPSAVPSDHG
MW755445_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MW887641_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MW887642_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MW887643_HBx_P-C          MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MW887647_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MW887649_HBx_P-C          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALXSPSSSAVPADHG
MW887650_HBx_P-C          MAARLCCQLDPARDVLXLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MW887651_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPTDHG
MZ439270_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MZ439307_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439312_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439313_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439315_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
MZ439332_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439334_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439336_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439338_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439341_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439345_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439366_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439369_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439371_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439376_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439382_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439385_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439387_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439392_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPSGALPSPSSSAVPADHG
MZ439396_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MZ439407_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439419_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439437_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439451_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGPLPSPSSSAVPTDHG
MZ439455_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPTDHG
MZ439486_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLTSPSSSDVPTDHG
MZ439571_HBx_P-C          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439575_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439596_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPPPSSSAVPADHG
MZ439601_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439602_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPADHG
MZ439606_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439613_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439617_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439624_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439625_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439626_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439629_HBx_P-C          MAARLCCQLDPARDILCLRPVGAESRGRPLSGSLGDLPSPSPSAVPADHG
MZ439630_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439634_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ439644_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
MZ439668_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439671_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439672_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439677_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439678_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439685_HBx_P-C          MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSSSTVPTDHG
MZ439686_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439710_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPFGTLPSPSSSAVPADHG
MZ439720_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAECRGRPVSGPFGTLPSPSSSAVPADHG
MZ439728_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ439730_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFETLPSPSSSAVPADHG
MZ439733_HBx_P-C          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ671234_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ671235_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
MZ671240_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPANHG
MZ671241_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
MZ671242_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MZ671243_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MZ671244_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPANHG
MZ671245_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSASAVPTDHG
MZ671246_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ671247_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
MZ671249_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ671251_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MZ675789_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MZ675790_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MZ675792_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MZ675793_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALSSPSPSAVPADHG
MZ934422_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGTLPSPSPSAVPADHG
MZ934424_HBx_P-C          MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MZ934425_HBx_P-C          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MZ934433_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGTLPSPSPSAVPADHG
OK106255_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
OM688312_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
OM688313_HBx_P-C          MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGALPSPSSSAVPADHG
ON093164_HBx_P-C          MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
ON402774_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
ON402776_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
ON402777_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
ON402779_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADQG
ON402780_HBx_P-C          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
X04615_HBx_P-C            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
X52939_HBx_P-C            MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSVVPADHG
X75665_HBx_P-C            MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSLSAVPANHG
AB048701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB078031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB090268_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB090269_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSSDHG
AB090270_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB104710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB104712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB109475_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB116266_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSSDHG
AB119251_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTPSSPSPSAVSSDHG
AB126581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB188241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AB188242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
AB188244_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205127_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205128_HBx_P-D          MAARLCCQLDLARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSSDHG
AB210820_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
AB222709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB222710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGTLSSPSPSAVSTDHG
AB222711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
AB222712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB222713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHG
AB246347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
AB246348_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
AB270537_HBx_P-D          MAARLCCQLDPAWDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB270539_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPPDHG
AB270540_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270541_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270542_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSSDHG
AB270543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270546_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270548_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSLSAVSTDHG
AB270549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270550_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLSSPSPSAVSTDHG
AB330367_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSSDHG
AB330369_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB493846_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB555496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPHPFAVSSDHG
AB555497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
AB555501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSSDHG
AB674403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
AB674404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674411_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674413_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674414_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB674415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSSDHG
AB674416_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674417_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674419_HBx_P-D          MAARLCCQLDPARDVLCLRPVEAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLRSLSSPSPSAVSTDHG
AB674422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674423_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
AB674424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674425_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674426_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGTLGTLSSPSPSAVSTDHG
AB674427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674429_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
AB674431_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
AF043593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AF121239_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AF151735_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AJ131956_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AJ344116_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGTISSPSPSAVSTDHG
AJ627215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSVHG
AJ627216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AJ627219_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AJ627220_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHG
AJ627222_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVXTDHG
AJ627223_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGSLGTLSSPPPSAVSTDHG
AJ627224_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AM422939_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY090452_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY161150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161157_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161158_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY233291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
AY233292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233294_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233296_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY236160_HBx_P-D          MAARPCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY236162_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
AY236164_HBx_P-D          MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY661792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY661793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AY721605_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY721607_HBx_P-D          MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721609_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
AY721610_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
AY721612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY741794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
AY741798_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY796030_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY796031_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGIFSSPSPSAVSSDHG
AY796032_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
DQ111986_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ304547_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ304548_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ304550_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ315778_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
DQ329356_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHG
DQ336674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336680_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336682_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
DQ336686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ399006_HBx_P-D          MAARLCCQLDPARDVLCLRPVVAESRGRPFSGPLGTLSSPSPSAVSSDHG
DQ464168_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464169_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464174_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464175_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPRNHG
DQ464178_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSTSPSAVPTDHG
DQ464181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPTDHG
DQ486021_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ486023_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPSAVSPNHG
DQ486025_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVPTDHG
EF103275_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHG
EF103276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EF103279_HBx_P-D          MAGRLCCQRDLARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EF103280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVSTDHG
EF594771_HBx_P-D          MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
EF594774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
EU155893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU414135_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EU414138_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414139_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
EU414140_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTNHG
EU414141_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
EU414142_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU414143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594382_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594396_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
EU594397_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594398_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594400_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594404_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594411_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
EU594433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
EU594434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU787437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
EU787438_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EU787447_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
EU919197_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
EU921418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPTDHG
EU939681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349206_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPPAVSSDHG
FJ349208_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSSDHG
FJ349211_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349213_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSTGTLSSPSPSAVPTDHG
FJ349214_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349216_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVSTDHG
FJ349235_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
FJ386590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
FJ562309_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSDHG
FJ562338_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGSLGTLSSPSPSAVPTDHG
FJ692532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
FJ692533_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRTLSSSSLPAVPTDHG
FJ876242_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ876253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ876256_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876257_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ899792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904399_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
FJ904402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904410_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
FJ904412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
FJ904415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHG
FJ904418_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904420_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHG
FJ904422_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904427_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904429_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVSTDHG
FJ904433_HBx_C-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGGLSSPSLPAVPTDHG
FJ904435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGDLSSSSLPAVPADHG
FJ904438_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904439_HBx_P-D          MAARLCCQLDPTRDVLCLRPLGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904446_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
GQ183457_HBx_P-D          MADRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHG
GQ183478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ183484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
GQ205380_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
GQ205384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
GQ205385_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205388_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ377589_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ477452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ477457_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ477458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
GQ477459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
GQ922000_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ922001_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922002_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922003_HBx_P-D          MAARLCCQLDPARDXLCLRPLSAESRGRPXSGPLGPLSSSSLPAVPTDHG
GQ922004_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPISXPLGSLSSSSLPAVPTNHG
GQ922005_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPLGPLSSSSLPAVPPDHG
GU456635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
GU456637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLASPSPSAVSTDHG
GU456638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GU456639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSTVSTDHG
GU456643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSTDHG
GU456644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVSTDHG
GU456645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPTPSAVSTDHG
GU456646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDYG
GU456649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456650_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPASSAVSTDHG
GU456651_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTISSSSPSAVSTDHG
GU456652_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVPTDHG
GU456653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSSSPSAVSTDHG
GU456658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDYG
GU456664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456665_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
GU456667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456668_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPTPSAVSSDHG
GU456669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSASPSAISTDHG
GU456670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
GU456671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GU456672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
GU456673_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
GU456674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSTPSPSAVSTDHG
GU456675_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVSTDHG
GU456677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456678_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSPSAVSTDHG
GU456680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456681_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTATVSTDHG
GU456683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPTDHG
HM750152_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
HM750153_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750156_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ236014_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
HQ236015_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
HQ236016_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAIPTDHG
HQ700439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ700455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ700458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPLGTLSSPSTSAVSTDHG
HQ700472_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLSSPSTSAVSTDHG
HQ700480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSTSAVSTDHG
HQ700483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700489_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700510_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
HQ700512_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700514_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ833465_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
HQ833469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSPISTDHG
JF754590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754592_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JF754593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JF754594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754597_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
JF754598_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSTDHG
JF754603_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754604_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTFSSSSPSAVSTDHG
JF754605_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JF754606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSTSAVSTNHG
JF754607_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754608_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754609_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754614_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JF754615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSSSPSAVSTDHG
JF754617_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754619_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754621_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHG
JF754622_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JF754625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGTESRGRSFSGSLGTFSSPSPSAVPTDHG
JF754627_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF754628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JF754629_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
JF754630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JF754632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
JF754633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754634_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSXSAVSTDHG
JF754635_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSTDHG
JF911683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF911685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF911687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF911690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
JN040750_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040752_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSHSAVSTDHG
JN040754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPSAVSTDHG
JN040757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040758_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040759_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN040760_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040762_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGPFSSPSPSAVSTDHG
JN040766_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
JN040767_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
JN040768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040773_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040774_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN040775_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040776_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN040779_HBx_P-D          MAARLYCQLDPARDVLCLRPVVPESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040781_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN040782_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSSDHG
JN040783_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040786_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JN040787_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040788_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JN040792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTISSSSPSAVSTDHG
JN040795_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040796_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040799_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040800_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040801_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040802_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSSSPSAVSTDHG
JN040804_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040805_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040806_HBx_P-D          MAARLRCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040807_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040808_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTISSPSPSAVSTDHG
JN040809_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040810_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040811_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040812_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040813_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
JN040814_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSTSAVSTDHG
JN040815_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040818_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHG
JN040819_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
JN040820_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSTVSSDHG
JN040821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040822_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSADHG
JN040823_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JN040824_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040826_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSTVHG
JN040828_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN040830_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JN257149_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPLGTLSSPSPSAVSTDHG
JN257150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257152_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSSDHG
JN257153_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPXPSAVSPNHG
JN257159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPTSAVSTDHG
JN257160_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN257162_HBx_P-D          MAARLCCQLDPXRNVLCLRPVGAESRGRPFSGPLGTLSSPSPXAVSTNHG
JN257163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257165_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
JN257170_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257172_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257176_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257178_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257179_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSSDHG
JN257181_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN257183_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257185_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257187_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN257190_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLTSPSPSAVSTDHG
JN257193_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN257195_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSPNHG
JN257200_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN257202_HBx_P-D          MAARLCCQLDPARDVLCXRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257203_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257205_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257209_HBx_P-D          MAARMCCQLDTARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
JN257211_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSADHG
JN574723_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN574725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JN574728_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JN642126_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642128_HBx_P-D          MAARLCCQLDPARDVLCLRPVGDESRGRPFSGPLGTLSSPSPSAVSPNHG
JN642129_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642130_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642132_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642133_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642135_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642136_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
JN642138_HBx_P-D          MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPLGTLTSPSPSAVSTDHG
JN642140_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN642142_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642143_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642144_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642145_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642146_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTNHG
JN642147_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSTDHG
JN642148_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALTSPSPSAVSTDHG
JN642149_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642150_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642151_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642153_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN642154_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
JN642155_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642156_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
JN642157_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642158_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642159_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642161_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
JN642162_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642163_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN642165_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642166_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642167_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFSSPSPSAVSTDHG
JN664909_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664910_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
JN664912_HBx_P-D          MAARLCCQLDLARDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
JN664913_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664918_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN664919_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
JN664921_HBx_P-D          MAARLCCQLDPARDILCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664926_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664927_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
JN664931_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSHHG
JN664939_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN664941_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSSSAVSSDHG
JN664947_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGPRSSSHPSAVPTDHG
JN688678_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDYG
JN688679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688683_HBx_P-D          MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXLGTLSSPSPSAVPXDHG
JN688685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
JN688695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN688708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGXLGTXSSPSPSAVPTDHG
JN688710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688712_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN688722_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN792903_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792904_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792911_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792912_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JQ032005_HBx_P-D          MAARLCCQLVPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JQ032006_HBx_P-D          MAARLCCHGVPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ032007_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JQ272897_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
JQ518361_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
JQ687530_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
JQ687531_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSSDHG
JQ707476_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707477_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707483_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707489_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTRSSPSPSAVSSDHG
JQ707491_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707493_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRPSPSPSAVSSDHG
JQ707494_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707497_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707498_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707506_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707508_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSSSAVSSDHG
JQ707509_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707510_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707511_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707526_HBx_P-D          MAARLCCQLDPTRDVLCFRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707528_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707530_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSLSAVSSDHG
JQ707682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707687_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ927384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPXTPAVSSDHG
JX096954_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX096955_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
JX096957_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX470760_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JX898689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898697_HBx_P-D          MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC012652_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
KC774436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTLSSPSPSAVPTDHG
KC774437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC774440_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESSGRPFSGPLGTLSSPSPPAVSTDHG
KC774444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPPAVSTDHG
KC774445_HBx_P-D          MAVRLCCQLDRARDVLCLRPVGAESRGRPFSGPLGILLSLCPFAVSSDPG
KC774459_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KC774460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFQGPAGTLSSPSPSAVPTDHG
KC774462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSSDPG
KC875275_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875276_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875279_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
KC875281_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875282_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875283_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875284_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875286_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875287_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875291_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875293_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875299_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875300_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875302_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875303_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875304_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875306_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875311_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875312_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875314_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875315_HBx_P-D          MAARLCCQLDPARDVLCLRPGGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
KC875318_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVPTDHG
KC875320_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875324_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875328_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875329_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875330_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875331_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875333_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875335_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875340_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875342_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF018208_HBx_P-D          MAARVCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018210_HBx_P-D          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF061167_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061170_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF170739_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF192830_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF471640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
KF471642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471645_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSTSAVSTDHG
KF471646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471647_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSTDHG
KF471651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KF471653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
KF471654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471658_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471660_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KF679990_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSFGTLTSPSPSAVPTDHG
KF679992_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679995_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVSSDHG
KF679997_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF922432_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSSSLPAVPTDHG
KJ470885_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470889_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470893_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470894_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470895_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470896_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ647352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSSSPSAVSTDHG
KJ647353_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRSLGTLSSPSPSAVPXDHG
KJ647355_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KJ843187_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
KJ997852_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997860_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997861_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM519455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM524338_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPPAVPTDHG
KM524339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAISSPPPSAVSTDHG
KM524341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524344_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524345_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM524346_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524347_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KM524348_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KM524349_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM524352_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KM524356_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
KM524358_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KM577668_HBx_P-D          MAARLCCQLDTARDVLCLRPVSAESRGRPVSGPLGTLASPSPSAVSTDHG
KM577669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPPAVSTDHG
KM577670_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPSAVSTDHG
KM606744_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KM606745_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGSLGTLSSPSPSAVPTDHG
KM606752_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTVHG
KM606753_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KM606754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KM606755_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KP090177_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090179_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTAHG
KP168419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPSTPPVSPDHG
KP317981_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP317983_HBx_P-D          MAARLCCQLNPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP995100_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KR811561_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812075_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812091_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812092_HBx_P-D          MAARLCRQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812093_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812105_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812106_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KT151620_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235615_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSTDHG
KT235621_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
KT347090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366491_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSVVSSDHG
KT366493_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
KT366499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSHSTSALSTDHG
KT366508_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPSPSAVSTDHG
KT749821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
KT749823_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVPTDHG
KT749827_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSPSAVSSDHG
KT749828_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
KT749845_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT963508_HBx_P-D          MAARMCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KU668434_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668436_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668439_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668447_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668448_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668449_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
KU736924_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736926_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KU736927_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KX276856_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX276857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KX357622_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
KX357639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTHSSPSPSAVSTDHG
KX423692_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX423693_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSNHG
KX423695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KX423696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KX423698_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423710_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGTLSSPSPSAVSSDHG
KX423711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KX423719_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGSLSSPSPSAVSSDHG
KX827290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSTVSTDHG
KX827292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KX827300_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
KX827301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KY629630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLSAVSTDHG
KY629633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY629634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
L27106_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
LC365689_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
LC705462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
LT992454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPPDHG
M32138_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF618341_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618342_HBx_P-D          MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
MF618343_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MF618349_HBx_P-D          MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
MF925363_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MF925366_HBx_P-D          MAARLCRRLEAARDVLCLRPVGAESRGRPLPGPLGALPSPSPSAVPTDHG
MF925379_HBx_P-D          MAARLFCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPTVHG
MF925383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925390_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
MF925391_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSADHG
MF925393_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776378_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776379_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776382_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776384_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776386_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTNHG
MG776389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALASPSPSAVSTDHG
MG776391_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776392_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFAGPLGTFSSPSPSAVSTDHG
MG776393_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776396_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
MG776397_HBx_P-D          MAARLCCQLGPARDVLCLRPVSAESRGRPFSGPLGTLPSPAASAVPPNHG
MG776398_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776405_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776409_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776410_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHG
MG776412_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAISTDHG
MG776415_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776416_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776417_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776419_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776421_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776424_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
MG776428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPCTVSTDNG
MG776433_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVSTDHG
MG776435_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776436_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776438_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSADHG
MG776441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSSDHG
MG776442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776444_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776451_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776457_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776461_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776464_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776473_HBx_P-D          MVVRLCCQQDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776484_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSASAVSTDHG
MG776487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776490_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776491_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776495_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776498_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVPTDHG
MG776500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776502_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776505_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776507_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776509_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776516_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776518_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776520_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
MG776522_HBx_P-D          MAARLCCQLDPARDVXCLRPVGAESRGRPFSGPLGTFSSPSPSXVSTDHG
MG776524_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776525_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MG776527_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776528_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776529_HBx_P-D          MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776532_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776535_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776536_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776539_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776543_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776544_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776546_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MG776547_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776548_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776549_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776553_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776555_HBx_P-D          MAARLCCQLDPARDVVCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776558_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776559_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776563_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776566_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776567_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776568_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776571_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776572_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776574_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776576_HBx_P-D          MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776578_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSASAVSTDHG
MG776579_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776581_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776582_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSACAVPPNHG
MG776585_HBx_P-D          MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776590_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSADHG
MG776592_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776593_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776594_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVPTDHG
MG776595_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776597_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776599_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776600_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776602_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776603_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776604_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776606_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSTDHG
MG776610_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776611_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSVVSTRHG
MG776612_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776613_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776616_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776619_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
MG776623_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MG776624_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRRRPFSGPLGSLSSPSPSAVSTDHG
MG776625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776630_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MG776632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776644_HBx_P-D          MAARLCCQPDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPPAVSTDHG
MG776649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MG776657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSADHG
MG776658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MG776666_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776667_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776668_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776670_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776680_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776682_HBx_P-D          MAARMSCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776687_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776691_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
MG776692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776712_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRTLGTLSSPSPSAVSTDHG
MG776714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776723_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTIHG
MG776725_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MG776726_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776731_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776732_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776736_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSASAVSPNHG
MG776738_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
MG776742_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776747_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776748_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776749_HBx_P-D          MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPYPSAVSTDHG
MG776751_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776754_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776757_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MG776759_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776760_HBx_P-D          MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776761_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGTPGTLSSPSPSAVSTDHG
MG776763_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776766_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSADHG
MG776770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
MG776776_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776777_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776781_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776789_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776790_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776791_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSASAVPPNHG
MG776793_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAVSTDHG
MG776796_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG877718_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MG877719_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MH464834_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464836_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464838_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464841_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPXDHG
MH464844_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464854_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH724215_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MH724217_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724223_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724225_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724226_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724232_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH724233_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MH724235_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724236_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MH724237_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724238_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPFPSAVSTDHG
MH724241_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724242_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724244_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724245_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
MH724247_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724251_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MH724252_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MK052947_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052948_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052949_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052950_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052952_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052954_HBx_P-D          VAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052956_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052959_HBx_P-D          MAARLCCQLDPARDVPCLRPVSAESGGRPVSGPPGTLSSPSPSAVPPDHG
MK052960_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPPPSAVPPDHG
MK052961_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052963_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052971_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052972_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052974_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPNHG
MK355500_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK355501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MK507911_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
MK507912_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MK507913_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK516278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK541688_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK598636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGLPFSGPLGDLSSPSPSAVSTDHG
MK598638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598640_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MK598643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
MK598644_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MK598645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598648_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
MK598649_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598655_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598657_HBx_P-D          MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598661_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK598668_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPFGTLSSPSPSAVSTDHG
MK598673_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
MK598674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
MK598677_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618423_HBx_P-D          MAARLCCQLDPPRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618424_HBx_P-D          MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTPSSPSPSAVSSDHG
MK618426_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618427_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MK618428_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSTVSTDHG
MK618430_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MK618434_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618437_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSSDHG
MK618441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVSTDHG
MK618443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK693107_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK693108_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSFPSPSAVSTDHG
MN066376_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066378_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN066381_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066382_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
MN066383_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066385_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066386_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN066387_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066388_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN066389_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAASSDHG
MN066390_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
MN066394_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
MN066395_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066398_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066401_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
MN066402_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066403_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN066406_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066407_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSSDHG
MN066408_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182658_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182661_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSSDHG
MN182662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182664_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFSSPSPSAVSSDHG
MN182670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182675_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182683_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSSDHG
MN182690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN310706_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN310708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310715_HBx_P-D          MAXRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVPTDHG
MN476100_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPPLSAVPTDHG
MN507837_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MN585095_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTNHG
MN839643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN844881_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSPSAVSPNHG
MN844882_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT114169_HBx_P-D          MAARLCCQLDPARDVVCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MT114172_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MT579899_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT591276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MT591277_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MT591278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT591279_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT591281_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPIGGLSPPPLPAVPTDHG
MT603383_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603384_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603385_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPHPSAVSTDHG
MT603387_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPHPSAVSTDHG
MT603388_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSSHPSAVSTDHG
MT603389_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603390_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPHPSAVSTDHG
MT603392_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSRQVGTLSSPPPSAVSTDHG
MT603393_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603394_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603395_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSSDHG
MT603396_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVXTLSSPPPSAVSTDHG
MT603397_HBx_P-D          MAARLCCQLDPTRDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603398_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603399_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603400_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603404_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MW455166_HBx_P-D          MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601228_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSPDHG
MW601229_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601231_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTYHG
MW601234_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601237_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSSGHG
MW601238_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601240_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSTDHG
MW601242_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601243_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSADHG
MW601244_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSAVHG
MW601245_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSPSPSAVSTDHG
MW601246_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSSDHG
MW601247_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALSSPSPYAVSADHG
MW601249_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601250_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601253_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601255_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPIGPLSSPSPSAVSTNYG
MW601256_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601257_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601261_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601262_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MW601263_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601265_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601266_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601267_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601268_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTPSSSSPSAVSSDHG
MW601270_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSSDHG
MW601271_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601273_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601274_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601275_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVPTDHG
MW601276_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPPAVSSDHG
MW601277_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
MW601278_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSSPAVSADHG
MW601279_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MW601280_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601281_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSDHG
MW601282_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601285_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601286_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGAFSSPSPSAVPTDHG
MW601287_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601288_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MW601289_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601290_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601291_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MW601292_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MW601293_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSSDHG
MW601294_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSSPAVSTDHG
MW601295_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601297_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
MW601299_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601300_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601301_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601303_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601305_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601307_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLSSPSPSAVSTDHG
MW601308_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDDG
MW601311_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601312_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601314_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVSSSSLPAVPADHG
MW601315_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MW601318_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601319_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
MW601320_HBx_P-D          MAARLYCQLDPARDVLCLRPVVAESRGRPVSGPLGTLSSPSPPAVSSGLG
MW601321_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGTPGTLSSPSPSAVSTDHG
MW601323_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRPLGSLSSPSLPAVPTDHG
MW601325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601326_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601328_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGGLSSPSPSAVSSDHG
MW601329_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601330_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MW601331_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MW601332_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601333_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601334_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601335_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601336_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MW601337_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601339_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSPGTLSSPSPSAVSTDHG
MW675897_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
MW675898_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097624_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVSSDHG
MZ097625_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097626_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097627_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MZ097628_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097631_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPPGTLSSPSPSAVSTDHG
MZ097632_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097633_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLPSPSPSAVSSDHG
MZ097634_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGALSSPSPSAVSSDHG
MZ097635_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097636_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097637_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSTDNG
MZ097638_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097639_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
MZ097641_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGGLSSPSPSAVSSDHG
MZ097642_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097643_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097645_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097646_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097647_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097651_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097653_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTXSSPSPSAVSTDHG
MZ097654_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPPAVSSAHG
MZ097655_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097656_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVPTDHG
MZ097657_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097659_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHG
MZ097660_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097661_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097662_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097663_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPAPSAVSTDHG
MZ097664_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSXSPSAVSTDHG
MZ097665_HBx_P-D          MAARLCCQLDPXRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097668_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHG
MZ097669_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSTSAVSADHG
MZ097670_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097671_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097672_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097673_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
MZ097674_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097675_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097676_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097677_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097679_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097682_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097683_HBx_P-D          MAARLXCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSSDHG
MZ097684_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097685_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097686_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097689_HBx_P-D          MAARLCCQLDPARDVLRLRPVGAESRGRPFSGSLGTLSSPSSIAVSTDHG
MZ097690_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGTLGTLSSPSPSAVSTDHG
MZ097691_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSWALGTLSSPSPSAVSSDHG
MZ097692_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097693_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097694_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MZ097695_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHG
MZ097696_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MZ097697_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MZ097698_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097699_HBx_P-D          MAARLCCQLDPARNVLCLRPVGAESRGRSFSGPLGALSSPSPSAVSTDHG
MZ097700_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAFSANHG
MZ097701_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSXDHG
MZ097704_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097705_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097707_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
MZ097708_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MZ097709_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTNHG
MZ097710_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVSSDHG
MZ097711_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVSTNHG
MZ097713_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGTLSSPSPSAVSTDHG
MZ097714_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097720_HBx_P-D          MAARLCCQLDPARDVLCLRPVDAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097729_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPXSGSLGDLSSPSPSAVSSDHG
MZ097730_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPXSGPLGTLSSPSPSAVSTDHG
MZ097733_HBx_P-D          MAARLCCQLDPARDVLCXRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097734_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097742_HBx_P-D          MAARLCCQLDXARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MZ097743_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRPLSSPSPSAVSTDHG
MZ097748_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MZ097749_HBx_P-D          MXGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097751_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097752_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097756_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097764_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097765_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSSPAVSTDHG
MZ097768_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097769_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097770_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTBHG
MZ097771_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097772_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097778_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097779_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPSAVSTDHG
MZ097780_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097782_HBx_P-D          MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097784_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSRPLGSLSSPSLPAVPTDXG
MZ097785_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097787_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097789_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097792_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGGLSSPSPSAVSTDHG
MZ097794_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGGLSSPSPSAVSSDHG
MZ097795_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
MZ097796_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097797_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097798_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
MZ097799_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSNHG
MZ097800_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSNHG
MZ097801_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097802_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSASAVPTDHG
MZ097803_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALASPSPSAVPTDHG
MZ097804_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGTLSSPSPSAVPTDHG
MZ097805_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097809_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDLG
MZ097810_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097811_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
MZ097812_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPPSSPSPSAVSTDHG
MZ097815_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097816_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097817_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097818_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MZ097819_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097820_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MZ097821_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097823_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097824_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097825_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097827_HBx_P-D          MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097828_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097829_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097830_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097832_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097833_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097834_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRTLSSPSPSAVSTDHG
MZ097836_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGPFGTLSSPSPSAVSTBHG
MZ097837_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097839_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097840_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097841_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
MZ097842_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MZ097843_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSFAVSTDHG
MZ097844_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097845_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097846_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSAIHG
MZ097847_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVSSDHG
MZ097848_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097851_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097853_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097855_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097857_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPVGTLSSPSPSAVSTDHG
MZ097858_HBx_P-D          MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
MZ097860_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
MZ097863_HBx_P-D          MAARLCCQLDPARDVLCLRPVGVESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097864_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFASPSPSAVPPDHG
MZ097865_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFEGPFGSLSSPSPSAVSTDHG
MZ097866_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097867_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSSDHG
MZ097869_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPXGSLSSSPPSAVPTDHG
MZ097870_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097871_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097872_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097873_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPAPSAVSSDHG
MZ097875_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097877_HBx_P-D          MAARLCCQLDPARDVLYLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097878_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDNG
MZ097879_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097880_HBx_P-D          MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097881_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPXPSAVSTDHG
MZ097882_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSAPSPSAVPTDHG
MZ097884_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDXSSPSLPAVPTDHG
MZ676995_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGALSSPSPSAVSTDHG
MZ711090_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MZ711091_HBx_P-D          MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ711092_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ740067_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820046_HBx_P-D          MAAKLCCQLDPAGDALCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ820047_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MZ820050_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820054_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ889444_HBx_P-D          -AARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
OK127811_HBx_P-D          -AARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK143467_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143468_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143472_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK143473_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPPAVSTDHG
OK143476_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OK143479_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTVDG
OK143480_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143486_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPVSGSLGTLSSPSPSAVPTVDG
OK143487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK143488_HBx_P-D          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143490_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
OK143496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSSDHG
OK998522_HBx_P-D          MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK998524_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
OK998527_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSSDHG
OL362106_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSXDHG
OL362107_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
OL362108_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPLGTLSSPSPSAVSTNHG
OL362109_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
OM025254_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304310_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPPASAVSTDHG
OM304311_HBx_P-D          MADRLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFPSPSTSAVSPDHG
OM304312_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSTDHG
OM304313_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304314_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
OM304316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPTAVSSDHG
OM304317_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304318_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSTPSPSAVSSDHG
OM304322_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM304323_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
OM304324_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM304325_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
OM304327_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
OM333239_HBx_P-D          MAARQCCQLDPSGHVLCLRPVGGKSRGGTFVGPLGPLSSPSPSAVSSDHG
OM721315_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
OM721316_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPTPSAVSTDHG
ON346437_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346438_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLSAVSADHG
ON346439_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLSAVSADHG
ON346440_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSASLSAVPTDHG
ON346441_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPTDHG
ON346442_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVPADHG
ON346443_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSASLSAVPADHG
ON346444_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346445_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346446_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVPTDHG
ON346447_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346448_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346449_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSADHG
ON346450_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLPAVSTDHG
ON346451_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPTDHG
ON346452_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVPTDHG
ON346453_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346454_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPSLSAVPTDHG
ON346455_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346456_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346457_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSAPLSAVPADHG
ON346458_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346459_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346460_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVSTDHG
ON346461_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVSADHG
ON346462_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVPADHG
ON346463_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLSAVPTDHG
ON346465_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLSAVPADHG
ON346466_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGALSSPSLPAVPADHG
ON346467_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPPLPAVPADHG
ON346468_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLPAVPADHG
ON346469_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVSADHG
ON346470_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVPADHG
ON346471_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346473_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346474_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346476_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346477_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVSADHG
ON346478_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSASLPAVSTDHG
ON346479_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVSTDHG
ON346480_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGALSSPPLSAVPTDHG
ON346481_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLPAVPADHG
ON346482_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346483_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPPLPAVPADHG
ON346485_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346486_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSASLSAVSADHG
ON346487_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSASLPAVPADHG
ON346488_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVSTDHG
ON346489_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSAPLPAVPTDHG
ON346490_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346491_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
ON346492_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346493_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLPAVPTDHG
ON346494_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346495_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLPAVPTDHG
ON346496_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLSAVPADHG
ON346497_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346499_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346500_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
ON346501_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVPADHG
ON346504_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346505_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPADHG
ON346506_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVPADHG
ON346507_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSASLPAVPADHG
ON346508_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVSTDHG
ON346509_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSAPLSAVPTDHG
ON346510_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFTGPLGALSSPPLPAVSTDHG
ON346511_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346512_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLSAVSTDHG
ON346513_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSPPLSAVSTDHG
ON346515_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
ON346516_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSPSLPAVPADHG
ON346517_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
ON346518_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346519_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSASLSAVSADHG
ON346520_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPPLSAVSTDHG
ON346521_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPLSAVPTDHG
ON346523_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346524_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346525_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSASLSAVPADHG
ON346526_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON585703_HBx_P-D          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
S41175_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSTVSTDHG
S77748_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
X02496_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
X59795_HBx_P-D            MAARLCCQLDPERDVLRLRPVGAESSGRPFSGPLGTLSSPSPSAVSSDHG
X65258_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
X80924_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
X85254_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTFSSPSPSAVPTDHG
X97848_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
X97849_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
Y07587_HBx_P-D            MAARLCCQLDPARDVLCLRPVGAESHGRPFSGSLGALSSPSPSTVSTDHG
AB091255_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGDLSSPSPSAVPADHG
AB091256_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
AB106564_HBx_C-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
AB194947_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB194948_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AB201287_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
AB201289_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
AB201290_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
AB205129_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205188_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205189_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205190_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205191_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
AB205192_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB219529_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
AB219534_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPADHG
AB274969_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGDLSSPTPSAVPADHG
AB274970_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274973_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274974_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274975_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPPPSAVPADHG
AB274976_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274977_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPAPSAVPADHG
AB274978_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPTPSAVPADHG
AB274979_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274980_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274981_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPPVHG
AB274982_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
AB274984_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPPASAVPADHG
AB274985_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915175_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AB915176_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915177_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPANHG
AB915178_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915180_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESSGRPVSGSLGDLSSPSPSAVPADHG
AM494689_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494690_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494691_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494692_HBx_P-E          MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494693_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494694_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494695_HBx_P-E          MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494697_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494698_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494699_HBx_P-E          MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494701_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGALSSPSPSAVPADHG
AM494702_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494703_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494705_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494706_HBx_P-E          MAARLCCQLDPARDVLCLRPVSVESCGRPVSGSLGDLSSPSPSAVPADHG
AM494707_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494710_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494711_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494712_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494832_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AY738144_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738147_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY739674_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY739675_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
AY935700_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060822_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060823_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
DQ060824_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADDG
DQ060825_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
DQ060826_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060830_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239217_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
EU239219_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
EU239220_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239222_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAKSCGRPVSGSLGDLSSPSPSAVPADHG
EU239223_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
EU239224_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGGLSSPSPSAVPADHG
EU239226_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
FJ349226_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDFSSPSPSAVPADHG
FJ349227_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ349237_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
FJ349239_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
FJ349240_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
FN545821_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN545822_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
FN545827_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN545841_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN545842_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN594748_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPXDHG
FN594749_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAVHG
FN594750_HBx_P-E          MAARLCCKLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594751_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTNHG
FN594752_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594753_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594758_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594759_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSXSPSAVPPDHG
FN594760_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594761_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAXHG
FN594762_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594765_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594766_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161757_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161759_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161760_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161762_HBx_P-E          MAARLCCQLDPARDVLCLRPVRAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161764_HBx_P-E          MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161765_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161768_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
GQ161771_HBx_P-E          MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGALSSPSPSAVPADHG
GQ161775_HBx_P-E          MAARLXCQLDXSRDVLCLRPVGAESRGRPLSGXLGTLSSPSPSAVPTDHG
GQ161776_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161778_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161781_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAIPADHG
GQ161782_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161783_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161785_HBx_P-E          MAARLYCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161790_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161796_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
GQ161797_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161801_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161803_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161807_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161810_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161812_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPPDHG
GQ161814_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161817_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSTVPADHG
GQ161820_HBx_P-E          MAARLCCQLDPARDVLCLRPVXAESCGRXVSGSLGDLSSPSPSAVPADHG
GQ161822_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161823_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
GQ161825_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSPGDLSSPSPSAVPADHG
GQ161831_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161833_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161834_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
GQ161836_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
HM363565_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVPGSLGDLSSPSPSAVPADHG
HM363566_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVTGSLGDLSSPSPSAVPAVYG
HM363568_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVLGSLGDLPSPSPSAVPADHG
HM363570_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363573_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363574_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
HM363575_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363576_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363578_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363579_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363582_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363584_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363586_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
HM363587_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363589_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363590_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363591_HBx_P-E          MAARMCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363592_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363593_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPTDHG
HM363594_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
HM363596_HBx_P-E          MAARLGCQLDPGRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSGVPADHG
HM363597_HBx_P-E          MGARMCCQLDPGRDVLCLRPVSAESWGRPVSGSLGDLSSPSPSAVPGDHG
HM363598_HBx_P-E          MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363599_HBx_P-E          MAARLCCQLDPARDVLRLRPVSGESWGRPVSGSLGDLSSPSPSAVPADHG
HM363600_HBx_P-E          MGARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDISSPSPSAVPAVHG
HM363603_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
HM363605_HBx_P-E          MAARLCCQLDPARDVLCIRPVSAESCGRPISGSLGDLPSPSPSAVPAVHG
HM363606_HBx_P-E          MAARLCCQLAPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363608_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363609_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363611_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700551_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
JQ000009_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ272902_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KF170741_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
KF170742_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
KF849714_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849715_HBx_P-E          MAARMCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849716_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849717_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849718_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849719_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDYG
KF849720_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPPPSAVPADHG
KF849723_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849724_HBx_P-E          MAARLYCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849725_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849726_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849727_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849728_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF922438_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KM606738_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KM606739_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
KR811564_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAXHG
KR811565_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAXHG
KR811571_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDHG
KR811574_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KR811894_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811897_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811898_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811906_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811907_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
KU736891_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736892_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736893_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736894_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGGLSSPSPSAVPADHG
KU736897_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736899_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736902_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
KU736903_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736904_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736909_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736910_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736911_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623842_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623843_HBx_P-E          MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPAVHG
LT623844_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESSGRPVSGSLGGLSSPSPSAVPADHG
LT623845_HBx_P-E          MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623846_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
LT623847_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
LT623849_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
LT623850_HBx_P-E          MAARLCCQLDTARDVLCLRPVSAESRGRPVSGSLGDLSSPSPSAVPADHG
LT623851_HBx_P-E          MAARLCCQLDPARDVLCLRPVXTESCGRPVPGSLGDLSSPSPSAVPAXHG
MF772354_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
MF772355_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
MF772356_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772358_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772359_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
MF772360_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
MF772361_HBx_P-E          MAARLCCQLDLARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772362_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MG776403_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776426_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776427_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776503_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776512_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776534_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCRRPVSGSLGDLSSPSPSAVPADHG
MG776729_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSPSAVSTDHG
MG776734_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776745_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776772_HBx_P-E          MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MG776797_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776800_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSSSPSAVPAVHG
MH464856_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPAVHG
MH580614_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580617_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580622_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580624_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580626_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580630_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580633_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580634_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580640_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580644_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580645_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580648_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580650_HBx_P-E          MAARLCCQLDPARDVLCLRPVNAESCGRPVSGSLGDLSSPSPSAVPADHG
MH918655_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSTVPADHG
MK321264_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEXCGRPVSGSLGDLSSPSPSAVPADHG
MK720631_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MN507840_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507843_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGDLSSPSPSAVPADHG
MN507844_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967526_HBx_P-E          MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967527_HBx_P-E          MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967528_HBx_P-E          MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSFGDLSSPSPSAVPADHG
MT570162_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGTLSSPSPSAVPADHG
MT570163_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
MT570164_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MW082636_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455162_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
MW455165_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MW926548_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRGLSSPSPSAVPADHG
MW926549_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPPPSAVPADHG
MW926550_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSASAVPADHG
MW926551_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGXLSSPSPSAVPADHG
MW926552_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
MW926554_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLXSSSPSAVPADHG
MW926555_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926556_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926557_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGGLSSPSPSAVPADHG
MW926558_HBx_P-E          MAARMCCQLDPERDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MW926559_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPXDHG
MW926560_HBx_P-E          MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926562_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSRSLGDLSSPSPSAVPADHG
MW926563_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926564_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
MW926565_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MW926566_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MZ962189_HBx_P-E          MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MZ962192_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MZ962198_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
OL362103_HBx_P-E          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OL362105_HBx_P-E          MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OM256457_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
ON402785_HBx_P-E          MAARLCCQLDPARDVLCLRPVSAESCGRPVSGTLGDLSSPSPSAVPADHG
AB036905_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036910_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADHG
AB036911_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
AB036914_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB064316_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AB086397_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AB116549_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB116551_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
AB116552_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
AB116654_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPSSPSAVPADDG
AB166850_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADHG
AB214516_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365446_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365449_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365450_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AF223962_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
AF223964_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AY090455_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
AY090456_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AY090458_HBx_C-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
AY090459_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090461_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
AY311369_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSTVQAYDG
AY311370_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
DQ629930_HBx_P-F          MAARLCCQLGPPRDGLYLHPVGADSRGRSLSGSLGVVPHPSQSAVPADDG
DQ629931_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629932_HBx_P-F          MAAGMCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629933_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629934_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629935_HBx_P-F          MAARLCCQMDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629936_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLRGPLGAIPPSSPSAVPANDG
DQ629937_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629938_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629940_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629941_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVSPHLPSAVPADDG
DQ629943_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629944_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRFLSGSLGVVPPPSPSAVPADDG
DQ629945_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629947_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629949_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629951_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629954_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629956_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPPSPSAVPANDG
DQ629958_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ629959_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
DQ629960_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSSSAVPADDG
DQ629965_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629966_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629967_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPRPLGAIPPSSPSAVPANDG
DQ629968_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629969_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629971_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629972_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
DQ629973_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629977_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629978_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629981_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629985_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629986_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ629987_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
DQ629988_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSTSAVPADDG
DQ629989_HBx_P-F          MAARLCFQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629991_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629993_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629995_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629996_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSRSLGAVPPPLPSATPADDG
DQ629997_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
DQ776247_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823087_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823088_HBx_P-F          MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
DQ823089_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823090_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823091_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
DQ899142_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899143_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899144_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899145_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899146_HBx_P-F          MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899148_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADHG
DQ899150_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
EF397982_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
EF576812_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPSSASAVPANHG
EU366132_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU670260_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EU670261_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EU670262_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ589065_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSFGAVSPPSPSAVPANDG
FJ589066_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
FJ589067_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
FJ657525_HBx_P-F          MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709457_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
FJ709458_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981181_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
HM585186_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM585194_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
HM585198_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSTVPADDG
HM585200_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
HM590474_HBx_P-F          MAAWLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM622135_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911673_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JF911676_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911678_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JF911692_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911693_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLTPSSPSAVPSDNG
JF911694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911695_HBx_P-F          MGARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPSDDG
JF911696_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPSSASAVPADHG
JN688691_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688699_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688701_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JN688709_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADXG
JN688720_HBx_P-F          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
JN792914_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792916_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792918_HBx_P-F          MAARLCCQLDPTRDVLCLRPVRAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792919_HBx_P-F          MAARLCCQLDPTRDVLCLRTVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792920_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272888_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
JQ272890_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272891_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272894_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAISPPSPSAVPADDG
JQ272895_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272898_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272900_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KC494394_HBx_P-F          MAARMCCKLDPERDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494395_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494396_HBx_P-F          MAARMCCKLDTARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494397_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494399_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494401_HBx_P-F          MAARLCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494402_HBx_P-F          MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494405_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KJ638656_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638657_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPABDG
KJ638660_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADDG
KJ638662_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADNG
KJ638663_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ638664_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPPDDG
KJ676694_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPXBDG
KJ843163_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843164_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843169_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843175_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843181_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843185_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843189_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843191_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KJ843195_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843196_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843201_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843202_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843205_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843207_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843209_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843212_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843220_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843223_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPPGGLPTSSASAVPADHG
KJ843225_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KM233681_HBx_P-F          MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
KM659861_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KM998715_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP718103_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPPSSSAVPADDG
KP718104_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP718106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGAVPPPSSSAVPADDG
KP718107_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSSSAVPADDG
KP718109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718110_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP718111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718112_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP995097_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGSLGAVPPSSPSAVPADDG
KP995098_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
KP995101_HBx_P-F          MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995104_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPFFPSTVPADDG
KP995105_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995106_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995107_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995109_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP995110_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995111_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995113_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGDVPPSSPSAVPADDG
KP995114_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPPGAVPPSSPSAVPADDG
KP995115_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPIGAVPPSSPSAVPADDG
KP995117_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995118_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGAVPPPSSSAVPADNG
KP995119_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVSPPSSSAVPADDG
KP995120_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995123_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995126_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSPGAVPPPSSSAVPADDG
KT896494_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KX264497_HBx_P-F          MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KX757663_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPXSGSFGAVSPPSPSAVPANDG
KX757665_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGSFGAVSPPSPSAVPANDG
KY458062_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPANDG
KY476322_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476324_HBx_P-F          MAARLYCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
KY476325_HBx_P-F          MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476326_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSLASAVPADNG
KY476329_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476330_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476331_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476332_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
MF593354_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593360_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593371_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRPLSGSLGAVSPPSPSAVPADDG
MF593380_HBx_P-F          MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MG001259_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098565_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098566_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098569_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSXASAVPADHG
MG098570_HBx_P-F          MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
MG098573_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
MG098574_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098575_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098577_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098578_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADYG
MG098579_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG098582_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLRALPPSSPSAVPADNG
MG098583_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG098584_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGGLPPSSPSAVPSDNG
MG877703_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVXADHG
MG877704_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVXADHG
MG877706_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877707_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877708_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877712_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MG877715_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877716_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877717_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MG877721_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MH051986_HBx_P-F          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MK183631_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183632_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183635_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGXLPPSSASAVPADHG
MK183637_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183638_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183641_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
MK183643_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
MK183645_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
ON585699_HBx_P-F          MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
ON585701_HBx_P-F          MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSTVPADNG
X75658_HBx_C-F            MAARMCCQLDPARDVLCLRPVGAESSGRTLPGPLGALPPSSASAVPADHG
X75663_HBx_P-F            MAARLCCQLDPARDVLCLRPVGAESSGRTLPGSLGAVPPPSSSAVPADNG
AB056513_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056514_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSTPSPFAVPADHG
AB056515_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064311_HBx_P-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064313_HBx_C-G          MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375168_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF160501_HBx_C-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
DQ207798_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF464097_HBx_P-G          MAARLCCHIDPFRDVLCLRPVSVESSGRPLLGSFGDLSPPSPSAVPADHG
EF464098_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF634480_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
FJ023674_HBx_P-G          MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPVGDLPSPSPSAVPAXHG
FR714503_HBx_P-G          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
GU563556_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
GU565217_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981174_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
HE981175_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707436_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707657_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707666_HBx_P-G          MAARLCCHLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707677_HBx_P-G          MAARLCCQLDPSRDVLCLRPDSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707680_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPAAHG
KF414679_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767451_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KJ194508_HBx_P-G          LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KM998716_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811460_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811765_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811767_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811774_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811775_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811777_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSTVPADHG
KR811780_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811783_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811784_HBx_P-G          MAARLCCQLDPSRDVPCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811785_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811791_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811792_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811793_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811794_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811797_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811800_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811804_HBx_P-G          MAARLCCQLDPTRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811806_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
MT426120_HBx_P-G          MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB059659_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059660_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB064315_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPANDG
AB179747_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB205010_HBx_P-H          MAARMCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPAVDG
AB266536_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB275308_HBx_P-H          MADRLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB353764_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPPSSPPVVPADDG
AB375159_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
AB375161_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375162_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB375163_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375164_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB818694_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AY090454_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDR
AY090457_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDG
FJ356715_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356716_HBx_C-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
HM117850_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSFGALPPSSPPAVPADDG
HM117851_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998718_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
KM998719_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998720_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPTDDG
KM998723_HBx_P-H          MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
MT622523_HBx_P-H          MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPANNG
AB014375_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
AB031265_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
AB033557_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB033558_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHG
AB048702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB049609_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB105172_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGDLPSPTSSAVPANHG
AB188243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB188245_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLSAVPTDHG
AB194949_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPFGTLSSPSPSAVPTDHG
AB195939_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195950_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
AB195955_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195956_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB198084_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
AB241109_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGALSSPSPSAVPADHG
AB270535_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPATHG
AB270538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLASPSPSAVPPDHG
AB300369_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB330368_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB367393_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGPESRGRPVSGSFGTLPSPSSSAVPADHG
AB367400_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367419_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367800_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB453985_HBx_P-RF-AC      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB493837_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPTGALPSPSSSAVPADHG
AB493838_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493840_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
AB493842_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AB583679_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVTSPSPSAVSTDHG
AB642096_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPFGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB674412_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
AB674432_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674434_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB674436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB933282_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB933283_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPXDHG
AF233236_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AF297619_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
AF297620_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF461361_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AJ344117_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
AM494716_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTNHG
AP011102_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGGLPSPSSSAVPADHG
AP011103_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPAAHG
AP011108_HBx_P-RF-CB      MAARLCCQLDTSRDVLCLRPVGAESRGRPVSGPFVPLPSSSSSAVPADHG
AY040627_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPTAHG
AY057948_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
AY161140_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AY161145_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPADHG
AY161146_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAIPSDHG
AY161147_HBx_P-RF-DA      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVQYDHG
AY206374_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGDLPSPSPSAVPADHG
AY233277_HBx_P-RF-AC      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY233293_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233295_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
AY236161_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY247030_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY341335_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
AY373430_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY800249_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATLG
AY817509_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AY817510_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGSLPSPSSSAVPAAHG
AY817511_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
AY817512_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSCSAVPAHHG
AY817515_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLG
AY862864_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY862865_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY862866_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
DQ089798_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ315777_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
DQ315779_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
DQ315780_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
DQ464164_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464165_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ478886_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPPSSAVPANHG
DQ478887_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478889_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478890_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLPSPSSSAVPADHG
DQ478897_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
DQ991753_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
EF103282_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF103284_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103285_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
EF494376_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSTAVPADHG
EF494378_HBx_P-RF-CA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185780_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
EU522070_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSVSAVPANHG
EU589337_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU594435_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU717211_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPATHG
EU787434_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
EU787435_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
EU833889_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU833890_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EU833891_HBx_P-RF-GC      MAARLCCQLDHARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
EU835240_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSSAVPAVHG
EU871981_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871983_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871984_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871986_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871987_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871994_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHR
EU871995_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFPSAVPADHG
EU871997_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
EU872014_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU872015_HBx_P-RF-CB      MAARVCCQLDPARGVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
EU881995_HBx_P-RF-CB      MAARVSCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916239_HBx_P-RF-CB      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU919166_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
EU919167_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
EU939547_HBx_P-RF-CB      MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLSSPSSFAVPADLG
EU939551_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
EU939565_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
EU939577_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU939581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939589_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSDSAVPAAHG
EU939602_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
EU939606_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSSSSSAVPADHG
EU939620_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU939621_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
EU939627_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939629_HBx_P-RF-BC      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939630_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939631_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939632_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
EU939668_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTVPSPSSSAVPADHG
FJ023659_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPAVHG
FJ023662_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
FJ023664_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023665_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023667_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPFGDLPSPSPSAVPAVHG
FJ023670_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ032337_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
FJ349207_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPPAVPTDHG
FJ349212_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349241_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
FJ361772_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSPSAVPANHG
FJ386578_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ386581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPPDHG
FJ386586_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
FJ386593_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386635_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
FJ386643_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
FJ386646_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPADHG
FJ386674_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
FJ518810_HBx_P-RF-BE      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSTSAVPADHG
FJ562223_HBx_P-RF-CD      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGILSSPSSSAVPADHG
FJ562227_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562229_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562247_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHG
FJ562263_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
FJ562267_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562271_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
FJ562278_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
FJ562287_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
FJ562302_HBx_P-RF-CB      MAARMCCQLDPALDVLCLRPVSAESRGRSLSGRFGTLPSPCSSAVPADHG
FJ562305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ562314_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
FJ562317_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPSGPLPSPSSSAVPADHG
FJ562328_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562336_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
FJ882610_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882614_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882617_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ904394_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904396_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904397_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSSSXPAVPADHG
FJ904398_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLSAVPTDHG
FJ904400_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904401_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904403_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGDLSSSSLPAVPADHG
FJ904404_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904405_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPANHG
FJ904406_HBx_P-RF-DE      MAARMCCQLDPARDVLCLRPVGAESCGRPFSGPLGDISSPSLPAVPTDHG
FJ904407_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904408_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904409_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
FJ904414_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904416_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904425_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLSSPSLPVVPTDHG
FJ904430_HBx_P-RF-DE      MAARLCCQLDTARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904437_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPADHG
FJ904440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904441_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904442_HBx_P-RF-DE      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904444_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPADHG
FJ904447_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FN594767_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPANHG
FN594769_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGDESCGRPFSGPLGDLPSPSLPAVPTDHG
FN594770_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPPLPAVPADHG
FN594771_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLSAVPTDHG
FR714490_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
FR714496_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCRRPLSGPLGDLSSSSASAVPPVHG
GQ161753_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
GQ161754_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
GQ161767_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ161788_HBx_P-RF-AE      MAARLCCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
GQ161806_HBx_P-RF-EA      MAARLXCQLDXSRDVLCLRPVSAESXGRPLSGSLGDLSSPSPSAVPTDHG
GQ161837_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ205378_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205379_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGSLSSSPPSAVPTDHG
GQ205386_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
GQ331048_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
GQ358155_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSSSSSAVPADHG
GQ358156_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
GQ377516_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSASAVPADHG
GQ377522_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
GQ377534_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
GQ377544_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGSESRGRPVSRPFGTLPSPSASAVPAAHG
GQ377548_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHG
GQ377560_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ377590_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377592_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPSVVPTDHG
GQ377594_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPXDHG
GQ377595_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377596_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377602_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377607_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377611_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ377614_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377626_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPTDHG
GQ377627_HBx_P-RF-CD      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377630_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPCVPTDHG
GQ377633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377634_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377635_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ475335_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ924618_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSTSAVPADHG
GU177079_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
GU357843_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HE981180_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHE
HF571060_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
HM146131_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
HM750133_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750142_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750144_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750145_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSFAVPANHG
HM750146_HBx_P-RF-DC      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
HM750149_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSSAVPAAHG
HM750150_HBx_P-RF-DC      MAARLCCQLDPARDVLCLCPVGAESRGRPFSGPPRSLPSPSSSAVPADHG
HQ684848_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
HQ700462_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPPSSAVPANHG
HQ700485_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700493_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPANHG
HQ700494_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGXLGXLSSPSLPAVPADHG
HQ700498_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
HQ700500_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700505_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPPGDLPSPSLPAVPADHG
HQ700507_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
HQ700508_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
HQ700509_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSLSAVPADHG
HQ700518_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRSVGAESRGRPVSGPLGDLPSPSSPAVPADHG
HQ700519_HBx_P-RF-CB      MAARLCCQLDTTRDVLCLRPVGAESSGRSVSGPLGDLSSPSPPAVPADHG
HQ700520_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPLGTLPSPSSPAVPAHHG
HQ700521_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESGGRSVSGPLGDLPSPSPPTVPADHG
HQ700523_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPIGDLPSPSSSAVPADHG
HQ700525_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPAXHG
HQ700526_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSLSAVPADHG
HQ700527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HQ700528_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700530_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPADHG
HQ700531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HQ700532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HQ700533_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700535_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700541_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700542_HBx_P-RF-CB      MAARLCCQLDPTRNVLCLRPVSAESRGRPVSRSLGDLPSPSSSAVPADHG
HQ700547_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSSSAVPADHG
HQ700554_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGDLPSPSSSAVPANYG
HQ700557_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700560_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700579_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700580_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
JF436919_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
JF436922_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHG
JF436923_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
JF439994_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440002_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440003_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440004_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440006_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440011_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440013_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSSSAVPTDHG
JF440015_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCRRPFSGSLGTLSSPSPSAVPTDHG
JF440017_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF491448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
JF491455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHG
JF754613_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
JF754616_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGPLSSPSPSAVSTDHG
JF828934_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828935_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN040798_HBx_P-RF-DE      MAARLCCQLDSARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040803_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN104438_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104442_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN257154_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVSTDHG
JN257164_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257174_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257189_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257191_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257204_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257206_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257210_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN400086_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN642127_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642137_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642141_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642160_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN664915_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPFSGSLGSLSSSHPSAVPTDHG
JN664929_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664933_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664934_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664935_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
JN664940_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPPGSLSSSPPSAVPTDHG
JN664943_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
JN688689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVPTDHG
JN688715_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXXGTLSSPSPSAVPXDHG
JN688717_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
JQ027310_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPXGTLPSPSSSAVPTDHG
JQ040130_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JQ040146_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040148_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ040174_HBx_P-RF-CB      MAARXCCQLDPARDVLCLRPVGAESRXRPVSGPFGXLPSPSSSAVPADHG
JQ040175_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ272887_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707421_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707441_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707445_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707456_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707457_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707465_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707466_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPIGTLSSPSPSAVPADHG
JQ707468_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707469_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPFPSAVPADHG
JQ707471_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ732168_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPACHG
JQ801476_HBx_P-RF-CG      MAARLCCQLDTSRDVLCLRPVSAESSGRPLSGPLGAFSPPSSSAVPADHG
JX026887_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX429896_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
JX429898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX504540_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
JX661485_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX661487_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPADHG
JX661494_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
JX661498_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
JX898687_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898693_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898696_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898698_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
JX898699_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
KC012653_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
KC172106_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
KC315400_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KC774178_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
KC774188_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPAAHG
KC774193_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774222_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPTDHG
KC774246_HBx_P-RF-CB      MVARVCCQVDHWRDVGSLRAVGPESRGRPVSPPWGRLRSPCSFAVPADHG
KC774258_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774294_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KC774307_HBx_P-RF-CB      MAAWVCCQLDPARDVLCLRPVSAESRGRPVSRPFGSLPSPSPSAVPADHG
KC774317_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774323_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPFGTLPSPSPSAVPADHG
KC774328_HBx_P-RF-CB      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774332_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774349_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSVESRGRPVSGPFGTLPSPSSSAVPAYHG
KC774414_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESCGRPISGPSGTLPSPSSSAVPADHG
KC774420_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774422_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVPSPSTSAVPANLG
KC774424_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774425_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPAAHG
KC774428_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAAHG
KC774430_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPASSAVPANHG
KC774431_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHG
KC774433_HBx_P-RF-DC      MAGRMGGQLDPARDVLCLRPVGGESRGRPFPGPFGFLRSPSSSAVPPDPG
KC774435_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774439_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774447_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHLG
KC774448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774450_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFQGPLGTLSSPSPSAVPTDHG
KC774453_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774458_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774461_HBx_P-RF-DC      MAARSCCQLDPARDVLFLRPVAVVSGRRPVSGPDGSFRSRLCFAVPAAHG
KC774466_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774470_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774472_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
KC774475_HBx_P-RF-DC      MAARVFCQLDPAGDVLCLRPVAVVSRRWPMSGPVGSFRSPSSFAVPANHG
KC774476_HBx_P-RF-DC      MAGRVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774478_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774479_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774481_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
KC774482_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774483_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774484_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774485_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
KC774486_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSAFAVPADHG
KC774487_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774488_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHG
KC774489_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774490_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774492_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774493_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
KC774495_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774497_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KC774498_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774499_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC875338_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875339_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF170740_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPPGDLSSPSLPAVPTDHG
KF192833_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192836_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192838_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192839_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF214656_HBx_P-RF-AC      MAARMYCQLDSSRDVLCIRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
KF214680_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSPAVPAVHG
KF219922_HBx_P-RF-GH      VAAGLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF471643_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVSTDHG
KF679991_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
KF873518_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873519_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873521_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KF873522_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KF873523_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXVPSPSSSTVPADHG
KF873524_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KF873527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873530_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAEPRGRPVSGPLGDLXSPSSPAVPADHG
KF873531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873535_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KF873537_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873538_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873540_HBx_P-RF-CB      MAARLCCXLDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873542_HBx_P-RF-CB      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF917451_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173299_HBx_P-RF-CB      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
KJ173300_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
KJ173320_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
KJ173325_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173329_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173349_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173350_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
KJ410506_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLPSPSSSAVPADHG
KJ410520_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ470884_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSLPAVPADHG
KJ470886_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470887_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470891_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
KJ470897_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470898_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ586803_HBx_P-RF-AF      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ586811_HBx_P-RF-DF      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KJ647349_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KJ647351_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ647356_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ803753_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSSSSSAVPTDHG
KJ803771_HBx_P-RF-DB      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KJ803772_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPSAVSTDNG
KJ803778_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803782_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KJ803785_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803788_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGSLGALPAASSSAVSTDHG
KJ803791_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ803798_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803802_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803804_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPIGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ803822_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KJ803827_HBx_P-RF-BC      MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPSPSSSAVPTDHG
KM213033_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KM359442_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
KM386676_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
KM524337_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
KM577666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPTDHG
KM606750_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM606751_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM875422_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSFSAVPADHG
KP148352_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPFGALPSPSSSAVPADHG
KP148441_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148442_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148450_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148586_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLEDLPSSSSSAVPSVHG
KP168416_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGVESCGRPVSGPLGAFSSPSLPAVPTDHG
KP168417_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHG
KP168420_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPIGDLSSPSLPAVPTDHG
KP168421_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPLGDLSSPSLPAVPTDHG
KP288875_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KP995112_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLPAVPTDHG
KR013843_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KT003704_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPAPHG
KT366492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT366504_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366505_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
KT991417_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991420_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991421_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
KT991427_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU519422_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSFSAVPAAHG
KU519423_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KU668440_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KU679939_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPPSSAVPADHG
KU679940_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KU679941_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KU679942_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
KU679943_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSPSAVPADHG
KU679944_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679945_HBx_P-RF-CB      MAARLCCELDPTRDVLRLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KU679948_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLAALPSPSSSAVPADHG
KU679950_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679952_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVXRPLGDLPSPSSPAVPADHG
KU679953_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679954_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
KU679955_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPXSSAVPADHG
KU679956_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAXPADBG
KU679958_HBx_P-RF-CB      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGDVPSPSSSTVPADHG
KU695741_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHG
KU695742_HBx_P-RF-CB      MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGALPSPSSSAVPADHG
KU695744_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPFGDVPSPSLSAVPADHG
KU695745_HBx_P-RF-CB      MAARLCCQLDPSXDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
KU695746_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGDLPSPSASAVPADHG
KU711666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVSTDHG
KU736914_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHG
KU736916_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPSLPAVPADHG
KU736917_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSPSLPAVPTDHG
KU736921_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHG
KU736923_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KU963856_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963936_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963938_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963940_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU964308_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964366_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964379_HBx_P-RF-DC      MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KX096713_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX357623_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357624_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357625_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KX357626_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDYG
KX357627_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KX357628_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357629_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGTLGTLSSPSLPAVPPDHG
KX357630_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357631_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDDG
KX357632_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVDAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357634_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357636_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSLPAVPPDHG
KX357641_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVCAESCGRPFSGPIGDLPSPSPPAVPTDHG
KX660674_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KX660675_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPITGPSGSLPSPSSSAVPADHG
KX660685_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX660686_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
KX660689_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSSAVPADHG
KX765835_HBx_P-RF-GC      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX774505_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPADHG
KX827299_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSLPAVPTDHG
KX827302_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KY363262_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHG
KY363272_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY363273_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY470843_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470844_HBx_P-RF-DC      IAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KY470845_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHG
KY470853_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGSLSSPSSSAVPADHG
KY470854_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470996_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470998_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHG
KY470999_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471003_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY629632_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPAAHG
KY670781_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPANHG
LC279263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279264_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC416040_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
M38454_HBx_P-RF-CB        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
MF488702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF593359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618346_HBx_P-RF-DE      MAARMCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
MF925381_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
MF925382_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925386_HBx_P-RF-AC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPASSAVPADHG
MF925389_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
MF925392_HBx_P-RF-DB      MAARLFHSLAAARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925401_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
MG826141_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826142_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MG826144_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADYG
MG826145_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MG826146_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPIGGLPSPSVSAVPADHG
MG826147_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MG826148_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MG826149_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826150_HBx_P-RF-BC      MAARVGCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSPAVPADHG
MG826151_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSSSSSAIPADHG
MG893554_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MG893559_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
MG893561_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
MH094410_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MH368022_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH464835_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPISRSLGTLSSPSPSAVPTDHG
MH481858_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481859_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481860_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481861_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481862_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH685719_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGSLGTLSSPSLPAVPTDHG
MH724222_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH724239_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724240_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSVVPTDHG
MH724243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK052957_HBx_P-RF-DE      MAARLCCQLGPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052967_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052968_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052969_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052970_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052976_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGSLSSPSPSAVPPDHG
MK321265_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK516279_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
MK534555_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534558_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPLPGPFGALPSPSSSAVPTDHG
MK534569_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534574_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPADHG
MK534579_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534584_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK534613_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLPSSSSSAVPTVHG
MK534615_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGSESRGRPLSGPPGALPPASPSTVPTDHG
MK534625_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534630_HBx_P-RF-BC      MAARLCCQLVTARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534637_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534641_HBx_P-RF-BC      MAARLCCRLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534648_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASSSAVPADHG
MK534653_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVIAESRGRPLSGPLGTLPSASSSAVPTDHG
MK534662_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSRSFGTLPSPSSSAVPADHG
MK534665_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLPSPSPSAVPADHG
MK534668_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534675_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
MK534679_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSSSAVPADHG
MK534681_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPSPSPSAVPTDHG
MK534686_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPADHG
MK534700_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGALPPASPSAVPTDHG
MK534701_HBx_P-RF-BC      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPPGALPPASPSAVPTDHG
MK534713_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534719_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSVVPTDHG
MK534725_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
MK534726_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534730_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVVAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534731_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MK534735_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSSSAVPADHG
MK534736_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
MK541689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSRSSSHPSAVPTDHG
MK598652_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MK598653_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MK598656_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK618439_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK618440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN650068_HBx_P-RF-DC      MAARVCCQLDPARDVLCLHPVGAESRGRPISGPLGSLPSPSSSAVPADHG
MN650069_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN650072_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
MN650074_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
MN650075_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
MN650076_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN650079_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVPADHG
MN650080_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSPSAVPADHG
MN650083_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSPSAVPADHG
MN650085_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGPLPSPSSSAVPADHG
MN657315_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN657316_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
MN683572_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
MN683574_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVSADHG
MN683579_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPAAHG
MN683580_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683581_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPTSSAVPADHG
MN683582_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVSADHG
MN683584_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHG
MN683588_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSSAVPADHG
MN683590_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSSSSSAVPADHG
MN683596_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAAHG
MN683597_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683603_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683607_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPITGPSGSLPSPSSSAVPADHG
MN683612_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683613_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVTGPFGSLPSPSSSAVPADHG
MN683617_HBx_P-RF-DC      MAARMCCQLDPARDVFCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683618_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPSGSLPSPSSSAVPADHG
MN683619_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSSSSSAVPATHG
MN683620_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSSSSSAVPATHG
MN683621_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
MN683625_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683630_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
MN683632_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPASSAVPADHG
MN683636_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683640_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683641_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683642_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683643_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHHG
MN683644_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHHG
MN683645_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPATHG
MN683647_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGGESRGRPVSGPFGSLPSPSSSAVPAPHG
MN683649_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHHG
MN683650_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
MN683651_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683652_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683653_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683655_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSFSAVPANHG
MN683660_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683662_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683663_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683664_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPLGSLPSPSSSAVPADHG
MN683669_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683671_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683673_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
MN683676_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGSLPSPSSSAVPAAHG
MN683677_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPFGSLPSPSSSAVPADHG
MN683680_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSSAVPADHG
MN683684_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MN683685_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHG
MN683686_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683687_HBx_P-RF-DC      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683692_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPANHG
MN683696_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683697_HBx_P-RF-DC      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683700_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGSLPSPSSSAVPADHG
MN683703_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683712_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGAIPSPSSSAVPADHG
MN683713_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSFAVPANHG
MN683715_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683716_HBx_P-RF-DC      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALPSPSSSAVPADHG
MN683717_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683720_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683721_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683723_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683724_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
MN683730_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MT426089_HBx_P-RF-AB      MAARVYCQLDSSRDVLCLRPVGAESRGRPLAGSLGTLSSPSPSAVPSAHG
MT426112_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLASPSPSAVPTDHG
MT426113_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSRSLGTLSSPSPSAVPTDHG
MT426114_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPLGDLSSPSLPAVSTDHG
MT591274_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSSSLPAVPADHG
MT645015_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSSSTVPTDHG
MT645035_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
MT645039_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANNG
MT645045_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPANHG
MT645048_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
MT645063_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPANHG
MT645065_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
MT645070_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
MT645071_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPSIHG
MW601227_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601230_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601235_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPPDHG
MW601260_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLSAESRGRPVSGSLGTLSSPSPSAVPTDHG
MW601284_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
MW601296_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGALSAPSPSAVPTDHG
MW601310_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPTPSAVPTDHG
MW601317_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAEPRGRPFSGSLGTLPSPSPSAVPTDHG
MW887645_HBx_P-RF-CD      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MZ043066_HBx_P-RF-AC      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPADHG
MZ097652_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097680_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097687_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097703_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097758_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
MZ097766_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVXTDHG
MZ097806_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097814_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097822_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097826_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097838_HBx_P-RF-DE      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097850_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ439768_HBx_P-RF-GC      MAARLCCQLDPARDVLSLRPVGAESCGRPLSGPLGDLSSSSASAVPPVHG
MZ439798_HBx_P-RF-GC      MAARLCCQLDPARDVLSLRPVGAESCGRPLSGPLGDLSSSSASAVPPVHG
OK143485_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OK143491_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFPGSLGTLSSPSPSAVPTDHG
OK143494_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OL362101_HBx_P-RF-EA      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OM732333_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
X65259_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
X68292_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X75656_HBx_P-RF-CB        MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
X80925_HBx_P-RF-DE        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHG
Y18856_HBx_P-RF-CB        MAARLCCQLDPARDILCLRPCGAESRGRPVSGSLGDLPSPSPS-VPADHG
Y18857_HBx_P-RF-CB        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPAFS-VPADHG
AY233287_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY934768_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX357646_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KX648548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464815_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464828_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ586810_HBx_P-RF-AF      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
JQ023660_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023661_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023662_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
JQ023663_HBx_P-A          MAARLCCQLDSSRNVLCLRPVGAESRGRPLPGPLGTLSSPSPSAVPSDHG
AB126580_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB222707_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300366_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480039_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB549213_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697492_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697493_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697495_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775198_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775199_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775200_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB775201_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937792_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937793_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937794_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090839_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF090840_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF536524_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ012207_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM282986_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295795_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295797_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295798_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM295799_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AM410963_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY707087_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY862867_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ788725_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU086721_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185786_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185787_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185788_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU185789_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594383_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594388_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594389_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594390_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594391_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594392_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594393_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594394_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU594395_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859898_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859899_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859902_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859904_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859905_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859907_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859908_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859909_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859910_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859911_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859912_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859913_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859914_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859915_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859916_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859918_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859919_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859920_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859921_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859922_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859923_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859924_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859925_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859926_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859928_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859929_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859931_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859935_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859936_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859937_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859939_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859940_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859942_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859945_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859946_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859947_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859950_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859951_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859953_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859954_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859956_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ414522_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477461_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477464_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477467_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477470_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477482_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477497_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477503_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477504_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563553_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563554_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GU563558_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576988_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
HE576989_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687529_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ687533_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707531_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707538_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707539_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707541_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707542_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707544_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707545_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707546_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707547_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707548_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707549_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707550_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707552_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707553_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707554_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707555_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707556_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707557_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707558_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707559_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707562_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707563_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707564_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707566_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707567_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707572_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707573_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707585_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707591_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707594_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707609_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707612_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707614_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707615_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707616_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707619_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707620_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707621_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707623_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707624_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707628_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707629_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707631_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707632_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707633_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707634_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707635_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707636_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707637_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707638_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707639_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707640_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707641_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707643_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707645_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707646_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707647_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707649_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707651_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707652_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707653_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707654_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707655_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707656_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX096952_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX096953_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843182_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843186_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843217_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ843218_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854708_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ854710_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606742_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606746_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KM606749_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP274928_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718087_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718088_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718089_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718095_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718096_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718097_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718098_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718099_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718101_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749830_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749831_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749835_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749837_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749843_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749844_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827293_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827294_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827295_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827296_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX827297_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY003230_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY382410_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC430617_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458430_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC458431_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC517161_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592168_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592169_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC592170_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426094_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426095_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426099_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043040_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043061_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043070_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043082_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043083_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043084_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043090_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143483_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143484_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
ON093162_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
X02763_HBx_C-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
Z72478_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ349222_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477493_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB116080_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB300367_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453979_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453980_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB453982_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480038_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480041_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697488_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697489_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697491_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697496_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697497_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697499_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697501_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697503_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697504_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697505_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697508_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697509_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697511_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB697512_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB937798_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KJ586809_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KY886219_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC074724_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311241_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311242_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC311243_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677081_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677082_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
LC677083_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MH932713_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MT426096_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AB480036_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AF090842_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366469_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366471_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AB453981_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697506_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB697507_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB453983_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843166_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843192_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ843214_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
OK106253_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB937796_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRPLARSLGTVSSPSPSAVPSDHG
EU594384_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU594386_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859933_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
EU859943_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
GU563555_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749824_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749829_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
KT749838_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVPADHG
AF537371_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AF537372_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ627228_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ904434_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477476_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477496_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043042_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143477_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AJ309370_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KX357642_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPLAGPLGTLSSPSPSAVPSDHG
AY161139_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
AY161143_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY161144_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGAVSSPSPSAVPTDHG
AY233284_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
AY233289_HBx_P-A          MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MF925361_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594760_HBx_P-C          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
AY738143_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
OK143498_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGVESRGRPLSGPLGTLSSPSPSAVPADHG
KP274925_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749850_HBx_P-A          MAARLYCQLDPSRDVLCLRPVSAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ692596_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692600_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FJ692604_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
DQ298164_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ298165_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU859955_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477468_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477484_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707533_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707534_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707561_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707565_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707569_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707574_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707575_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707576_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707577_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707578_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707579_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707580_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707583_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707584_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707586_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707587_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707588_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707590_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707593_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707595_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707596_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707597_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707599_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707600_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707601_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707602_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707603_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707605_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707606_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707607_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707608_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707622_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707627_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707630_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707610_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749836_HBx_P-A          MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ331047_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
KP274927_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ692578_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692579_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692582_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692583_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692584_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692585_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922426_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922427_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
KF922428_HBx_P-A          MAARLYCQLDSSRDVLCLRPVSAESRGRPFARSLGTLSSPSPSAVPSDHG
FJ692565_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692586_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692588_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
FJ692591_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
FJ692611_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FM199980_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
GU563548_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512459_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
MK512473_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLQGPLGTLSSPSPSAVPSDHG
FN545840_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
GQ477477_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043094_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
V00866_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
Z35717_HBx_P-A            MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477495_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043072_HBx_P-A          MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477501_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MZ043051_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
GQ477491_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JN182328_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182331_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182332_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JN182333_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLTGPLGTLSSPSPSAVPSDHG
JQ707300_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707301_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707302_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707303_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707304_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707305_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707307_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707308_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707310_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707311_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707312_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707313_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707314_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707315_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707316_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707319_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707320_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707321_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707322_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707323_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707324_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707325_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707326_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707327_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707328_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707330_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707331_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707332_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707333_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707334_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707336_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707337_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707338_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707339_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707341_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707342_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707343_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707344_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707345_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707346_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707347_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707349_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707350_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707352_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707354_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707355_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707356_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707357_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707358_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707359_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707360_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707361_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707363_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707364_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707365_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707366_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707367_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707369_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707370_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707318_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707372_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707373_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707375_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707377_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707378_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707379_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707381_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707382_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707384_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707386_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707387_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707388_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707390_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707391_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707392_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707393_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707394_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707395_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707396_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707399_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707404_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707406_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707407_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707408_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707409_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707410_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707412_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707413_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707415_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707416_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707417_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707419_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707420_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707389_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707398_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707385_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707402_HBx_P-A          MAARLYCQLDPSRDVLCLRSVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707536_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707540_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707658_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707661_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707662_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707663_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707664_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707665_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707667_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707669_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707670_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707674_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707675_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707676_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707681_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707613_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707618_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707644_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707648_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707598_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707650_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JX154580_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
JX154581_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLTGPLGPLSSPSPSAVPSDHG
KF922407_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922408_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922409_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPTDHG
KF922415_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922416_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922418_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922419_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922421_HBx_P-A          MAARVYCQLDSSRNVLCLRPVSAESRGRPLEGPLGTLSSPSPSAVPSDHG
KF922425_HBx_P-A          MAARVYCQLDSSRDVLCLRPVGAESRGRPLARSLGTLSSPSPSAVPSDHG
KF922430_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARSLGALSSPSPSAVPSDHG
KF922436_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESCGRPLAGPLGTLSSPSPSAVPSDHG
KJ010777_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ010778_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MT426091_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ843216_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
MF772353_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGALSSPSPSAVPSDHG
KJ854697_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854702_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KJ854706_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTLSSPSPSAVPSDHG
KM519453_HBx_P-A          MAARVYCQLDSSRDVLCLRPVSAESRGRSLTGSLGTLSSPSPSAVPSDHG
KT347092_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KP718091_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KP718100_HBx_P-A          MAARLYCQLDPSRDVLYLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT366466_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTISSPSPSAVPSDHG
KT366467_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KR905431_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366468_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT366470_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT749826_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749832_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749834_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749839_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749846_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749847_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KT749849_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
MN507849_HBx_P-A          MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPPRTLSSPSPSAVPADHG
KU605538_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
KU605539_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGALSSPSPSAVPSDHG
MG877724_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MG877725_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
MH464814_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464818_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH464830_HBx_P-A          MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVSSDHG
MH580639_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580642_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
MH580643_HBx_P-A          MAARLYCQLDTSRDVLCLRPVGAESRGRPLSGPLGPLSSPSPSAVPTDHG
D00329_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
KX276828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPSDHG
AB010291_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPSTVPTDHG
JX504543_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPCVPTDHG
AB073834_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073840_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924610_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815549_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815550_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815551_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815552_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815553_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815554_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815555_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815556_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815557_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815558_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815559_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815561_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815562_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815563_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815564_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815565_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815566_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815567_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815568_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815569_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815570_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815575_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815576_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815616_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815618_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815625_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815627_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815629_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815630_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815631_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815632_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815635_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815638_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815639_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815641_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815642_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815644_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815645_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341794_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341810_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341828_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341837_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX869998_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173424_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276815_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674450_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571337_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571342_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MT426100_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OM688314_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB073841_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB287329_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY167097_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448623_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924603_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GQ924611_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815617_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815619_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815624_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815628_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815633_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815634_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815636_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ040125_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341796_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ341807_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JQ801479_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JX661478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC315393_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963843_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963844_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963845_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963846_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963847_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963848_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963849_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963850_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963851_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963852_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU963853_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276793_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX276808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KX429647_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MG571372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MH061283_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF674387_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674423_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674461_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AP011085_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50521_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
D50522_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803755_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ803787_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429621_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KX429626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
LC349875_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674384_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674496_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MK534709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MW847941_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925370_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925402_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF674404_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674405_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674455_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MF674499_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
MW845286_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
AB195934_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
AB195935_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPIVPTDHG
DQ448620_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDHG
AB241117_HBx_P-B          MAARLCCQLDPARDVLCLRPLGAESCGRPLPGPLGALPPASPSAVPTVHG
AB287328_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
EU043342_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562321_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MW845306_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AB287315_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
AB287318_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659237_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
KP659247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EU306677_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306678_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306679_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306680_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
EU306681_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AB302943_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB302944_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPASPPAVPTIHG
AB471855_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
MK534601_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPMVPTDHG
AB931169_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPAVPTYHG
AF121245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPASPPVVPTDHG
X97851_HBx_P-B            MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
AP011091_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473976_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358140_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
GQ358141_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPLGALPPASPSAVPTDHG
EF473972_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
MG571336_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AY033073_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPSPVPTDHG
AY163870_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPASPPVVPTDHG
KC774388_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY596104_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPGVPTDNG
AY596105_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP036970_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220704_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ448622_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ993709_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU043343_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939667_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386654_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386683_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU357842_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774410_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803808_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148580_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148581_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KP148582_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059425_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059511_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059735_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171448_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK171546_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534571_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534711_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
OK106254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660227_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534660_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY220698_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939673_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386682_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ562231_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774394_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KM213034_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534703_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534705_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534708_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534706_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534714_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534715_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534728_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534729_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MK534734_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217358_HBx_P-B          MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
AY217360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ032357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
MK171478_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVLPTDHG
OM688316_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTVHG
DQ448626_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
DQ975271_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
FJ386666_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
GU815672_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF899335_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KC774377_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173381_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173382_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173413_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173414_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173415_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964244_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964245_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964246_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964247_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964248_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964250_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964251_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964252_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964253_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964254_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964255_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KU964256_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059357_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059358_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059359_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059360_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059361_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059362_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059363_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059364_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059365_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059366_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059367_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059368_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059369_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059370_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059371_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059372_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059373_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059374_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059375_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059376_HBx_P-B          MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
MF059377_HBx_P-B      &nbs