HBVdb

Dataset for protein SHBs of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

153 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FR821983_SHBs_P-G      MANITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM455794_SHBs_P-G      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455685_SHBs_P-G      MENITSGLLGTLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGGAPVCLG
EF464098_SHBs_P-G      MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGEVPVCPG
AB056515_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
EF464097_SHBs_P-G      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPVCPG
GQ325762_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AJ297870_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
GQ325763_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
EF634480_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
DQ207798_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AY168428_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AF405706_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AF369533_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AF160501_SHBs_C-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375166_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375167_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375168_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375169_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375170_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
DQ236116_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
DQ236117_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
DQ236119_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
DQ403176_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB056513_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB056514_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB056516_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB064310_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB064311_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB064312_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB064313_SHBs_C-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB375165_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
FR822067_SHBs_P-G      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023885_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023879_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MK568536_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FR821982_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023706_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTECLG
FJ023705_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023703_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023702_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023701_SHBs_P-G      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023700_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023707_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023674_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ023704_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486349_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPXCLG
KR230749_SHBs_P-G      MENITSGFLGPLLVLQAGVFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KM455592_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF779357_SHBs_P-G      MENITSGFLGPLLVLQAGYFVLTRFFTIPQSLDSWWTSLNFLGGVPVCPG
KF779267_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF414679_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849642_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGGPVCPG
JX849641_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPGCPG
HE981172_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HE981171_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
GQ325774_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF767451_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439791_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439789_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439788_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439787_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439786_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439784_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439782_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439781_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439779_SHBs_P-G      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HM467773_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849644_SHBs_P-G      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707680_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707673_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707671_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707668_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707666_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707660_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707657_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439794_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439793_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439792_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MT426120_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MN818847_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MN818846_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MN818845_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MK568529_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KY697840_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KY004111_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KX264500_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KM998716_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KJ194508_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF779235_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF779233_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF771917_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF767452_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF767450_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KC885585_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849646_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849643_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849639_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JX849638_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707679_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707678_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707677_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707436_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JN604208_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439818_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439817_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439816_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439815_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439814_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439813_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439812_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439811_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439810_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439809_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439808_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439807_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439806_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439805_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439804_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439803_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439785_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JF439780_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HM467770_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HM467769_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HM467765_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HE981176_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HE981175_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
HE981174_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
GU565217_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
GU563556_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
GQ325769_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPG
GQ325770_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPG
GQ325771_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXVPVCPG
GQ486843_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
EU366207_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
EU366208_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
EU366209_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023936_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESTVCLG
FJ023968_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ358594_SHBs_P-G      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023854_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGXXVCLG
FJ023878_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023880_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023881_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGGAPVCLG
FJ023882_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023883_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023884_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ358587_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR714503_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR821984_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR821987_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR822110_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR822113_SHBs_P-G      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
                       * . :**:**.**. *   *:**.::* **********:.***    * *

FR821983_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDY
KM455794_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM455685_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF464098_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB056515_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF464097_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ325762_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297870_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ325763_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF634480_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ207798_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY168428_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF405706_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369533_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF160501_SHBs_C-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375166_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375167_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375168_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375169_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375170_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236116_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236117_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236119_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ403176_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB056513_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB056514_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB056516_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064310_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064311_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064312_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064313_SHBs_C-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375165_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR822067_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023885_SHBs_P-G      QNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023879_SHBs_P-G      QNSQSPTSNHPPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568536_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR821982_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
FJ023706_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023705_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023703_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023702_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLLILLLCPIFLLVLLDY
FJ023701_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023700_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023707_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023674_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023704_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486349_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR230749_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM455592_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779357_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779267_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414679_SHBs_P-G      LNSQSPTSNHSLISCPPTCPGYRWMWLRRFIIFLFILLLCLIFLLVLLDY
JX849642_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849641_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981172_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981171_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ325774_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF767451_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439791_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439789_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439788_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439787_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439786_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439784_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439782_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439781_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439779_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467773_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849644_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707680_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707673_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707671_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707668_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707666_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707660_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707657_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439794_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439793_SHBs_P-G      LNSQSPTSNHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439792_SHBs_P-G      LNSQSPTSNHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT426120_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818847_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818846_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818845_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568529_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY697840_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY004111_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264500_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998716_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ194508_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779235_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779233_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771917_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF767452_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF767450_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC885585_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849646_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849643_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849639_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849638_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707679_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707678_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707677_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707436_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604208_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439818_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439817_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439816_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439815_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439814_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439813_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439812_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439811_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439810_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439809_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439808_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439807_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439806_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439805_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439804_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439803_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439785_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439780_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467770_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467769_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467765_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981176_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981175_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981174_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU565217_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU563556_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ325769_SHBs_P-G      LNSQSPTSNHSPXSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVXLDY
GQ325770_SHBs_P-G      LNSQSPTSNHSPXSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVXLDY
GQ325771_SHBs_P-G      LNSQSPTSNHSPXSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVXLDY
GQ486843_SHBs_P-G      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366207_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366208_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366209_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023936_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023968_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ358594_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023854_SHBs_P-G      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
FJ023878_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023880_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023881_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023882_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023883_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023884_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ358587_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR714503_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR821984_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFVLLLCLIFLLVLLDY
FR821987_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR822110_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR822113_SHBs_P-G      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
                        *********.  ***  *******  *.***** :**** ***** ***

FR821983_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSAGNCTCI
KM455794_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCIKPSDGNCTCI
KM455685_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EF464098_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB056515_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCIKPSEGNCTCI
EF464097_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325762_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AJ297870_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325763_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EF634480_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
DQ207798_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AY168428_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AF405706_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AF369533_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AF160501_SHBs_C-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375166_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375167_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375168_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375169_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375170_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
DQ236116_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
DQ236117_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
DQ236119_SHBs_P-G      QGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
DQ403176_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB056513_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB056514_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB056516_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB064310_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB064311_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB064312_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB064313_SHBs_C-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB375165_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR822067_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023885_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023879_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MK568536_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
FR821982_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023706_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023705_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023703_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023702_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023701_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023700_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023707_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023674_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023704_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ486349_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPLDGNCTCI
KR230749_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCI
KM455592_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF779357_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF779267_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCI
KF414679_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDRNCTCI
JX849642_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849641_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HE981172_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HE981171_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325774_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF767451_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439791_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439789_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439788_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439787_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439786_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439784_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439782_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439781_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439779_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HM467773_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849644_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707680_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707673_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707671_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKLSDGNCTCI
JQ707668_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707666_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707660_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707657_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439794_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKLSDGNCTCI
JF439793_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439792_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MT426120_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MN818847_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MN818846_SHBs_P-G      QGMLPVCPLIPGSSTTSTGTCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MN818845_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
MK568529_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY697840_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY004111_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KX264500_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KM998716_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KJ194508_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF779235_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF779233_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF771917_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF767452_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTSPAQGNSMYPSCCCTKPSDGNCTCI
KF767450_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KC885585_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849646_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849643_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849639_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JX849638_SHBs_P-G      HGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707679_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707678_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707677_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707436_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JN604208_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439818_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439817_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439816_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439815_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439814_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439813_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439812_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439811_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439810_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439809_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439808_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439807_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439806_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439805_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439804_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439803_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439785_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF439780_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HM467770_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTIPAQGNSMYPSCCCTKPSDGNCTCI
HM467769_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HM467765_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HE981176_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HE981175_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HE981174_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GU565217_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GU563556_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325769_SHBs_P-G      XGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325770_SHBs_P-G      XGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ325771_SHBs_P-G      XGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
GQ486843_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EU366207_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EU366208_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EU366209_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023936_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023968_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ358594_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023854_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023878_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023880_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023881_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023882_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023883_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023884_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ358587_SHBs_P-G      QGMLPVCPLVPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR714503_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR821984_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR821987_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR822110_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FR822113_SHBs_P-G      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
                        ********:.********.*.*** *******:***** *    *****

FR821983_SHBs_P-G      PIPSSWAFAKSLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
KM455794_SHBs_P-G      PIPSSWAFVKYLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWY
KM455685_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
EF464098_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
AB056515_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
EF464097_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
GQ325762_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
AJ297870_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
GQ325763_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
EF634480_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
DQ207798_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AY168428_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AF405706_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AF369533_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AF160501_SHBs_C-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375166_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375167_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375168_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375169_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375170_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
DQ236116_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
DQ236117_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
DQ236119_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
DQ403176_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB056513_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB056514_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB056516_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB064310_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB064311_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB064312_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB064313_SHBs_C-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
AB375165_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
FR822067_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023885_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023879_SHBs_P-G      PIPSSWAFAKYPWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
MK568536_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
FR821982_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023706_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLPAPFVQWFVGLSPTVWLSVIWMMWY
FJ023705_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLLVIWMMWY
FJ023703_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWY
FJ023702_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSIIWMMWY
FJ023701_SHBs_P-G      PIPSSWAFAKYLWGWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWY
FJ023700_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWY
FJ023707_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWY
FJ023674_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWY
FJ023704_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWY
GQ486349_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
KR230749_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KM455592_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
KF779357_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF779267_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF414679_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JX849642_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JX849641_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HE981172_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HE981171_SHBs_P-G      PIPSSWAFAKYLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
GQ325774_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWSVGLSPTVWLSAMWMMWY
KF767451_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439791_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILY
JF439789_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439788_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439787_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439786_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILY
JF439784_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSHTVWLSAMWMILY
JF439782_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILY
JF439781_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMILY
JF439779_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
HM467773_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JX849644_SHBs_P-G      PIPSSWAFAKYLWXWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JQ707680_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707673_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707671_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707668_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707666_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707660_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707657_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JF439794_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439793_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439792_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
MT426120_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
MN818847_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
MN818846_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
MN818845_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
MK568529_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KY697840_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KY004111_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KX264500_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KM998716_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KJ194508_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF779235_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF779233_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF771917_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KF767452_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
KF767450_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
KC885585_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JX849646_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JX849643_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JX849639_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JX849638_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JQ707679_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707678_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAISMMWY
JQ707677_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWY
JQ707436_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
JN604208_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
JF439818_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439817_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439816_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439815_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439814_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439813_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439812_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439811_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439810_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439809_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439808_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439807_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439806_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439805_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439804_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439803_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439785_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
JF439780_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
HM467770_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HM467769_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HM467765_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HE981176_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HE981175_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
HE981174_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
GU565217_SHBs_P-G      PIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAMWMMWY
GU563556_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
GQ325769_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXY
GQ325770_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXY
GQ325771_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAXXMXXY
GQ486843_SHBs_P-G      PIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWY
EU366207_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWF
EU366208_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWF
EU366209_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWF
FJ023936_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023968_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ358594_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWY
FJ023854_SHBs_P-G      PIPSSWAFAKYLWEWXSARFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWY
FJ023878_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023880_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023881_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023882_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023883_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ023884_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FJ358587_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLQVPFVQWFVGLSPTVWLSVIWMMWY
FR714503_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FR821984_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FR821987_SHBs_P-G      PIPSSGAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FR822110_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
FR822113_SHBs_P-G      PIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWY
                       ***** **.*  * * *.*****.  .***** .***  ***    *  :

FR821983_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
KM455794_SHBs_P-G      WGPRLYNILSPFILLLPIFFCLWVYI
KM455685_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
EF464098_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB056515_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
EF464097_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
GQ325762_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AJ297870_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCL----
GQ325763_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
EF634480_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
DQ207798_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AY168428_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AF405706_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AF369533_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AF160501_SHBs_C-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375166_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375167_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375168_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375169_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375170_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
DQ236116_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
DQ236117_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
DQ236119_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
DQ403176_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB056513_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB056514_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB056516_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB064310_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB064311_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB064312_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB064313_SHBs_C-G      WGPNLYNILSPFIPLLPIFFCLWVYI
AB375165_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
FR822067_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023885_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023879_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
MK568536_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
FR821982_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023706_SHBs_P-G      WGPNLYNTLSPFIPLLPIFFCLWVYI
FJ023705_SHBs_P-G      WGPNLYTTLSPFIPLLPIFFCLWVYI
FJ023703_SHBs_P-G      WGPNLYNTLSPFIPLLPIFFCLWVYI
FJ023702_SHBs_P-G      WGPNLYNTLSPFIPLLPIFFCLWVYI
FJ023701_SHBs_P-G      WGPNLYNTLSPFIPLLPIFFCLWVYI
FJ023700_SHBs_P-G      WGPNLYNTLSPFMPLLPIFFCLWVYI
FJ023707_SHBs_P-G      WGPNLYNTLSPFIPLLPILFCLWVYI
FJ023674_SHBs_P-G      WGPNLYXTLSPFIPLLPIFFCLWVYI
FJ023704_SHBs_P-G      WGPNLHNTLSPFIPLLPIFFCLWVYI
GQ486349_SHBs_P-G      WGPSLYNIXSPFIPLLPIFFCLWVYI
KR230749_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KM455592_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
KF779357_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF779267_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF414679_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849642_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849641_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HE981172_SHBs_P-G      WGPNLYNILSPFIPLLPIFFFLWVYI
HE981171_SHBs_P-G      WGPNLYNILSPFIPLLPIFFFLWVYI
GQ325774_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF767451_SHBs_P-G      WGPNLYSILSPFIPLLPIFFCLWVYI
JF439791_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439789_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439788_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439787_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439786_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439784_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439782_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439781_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439779_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HM467773_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLLVYI
JX849644_SHBs_P-G      WGPNLYNILSPFIPLLPIFFXLWVYI
JQ707680_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707673_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707671_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707668_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707666_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707660_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JQ707657_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JF439794_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JF439793_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
JF439792_SHBs_P-G      WGPNLYNILSPFLPLLPIFFCLWVYI
MT426120_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
MN818847_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
MN818846_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
MN818845_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
MK568529_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KY697840_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KY004111_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KX264500_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KM998716_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KJ194508_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF779235_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF779233_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF771917_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF767452_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KF767450_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
KC885585_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849646_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849643_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849639_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JX849638_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JQ707679_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JQ707678_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JQ707677_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JQ707436_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JN604208_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
JF439818_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439817_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439816_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439815_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439814_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439813_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439812_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439811_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439810_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439809_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439808_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439807_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439806_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439805_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439804_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439803_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439785_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
JF439780_SHBs_P-G      WGPNLYNILSPFIPLLPIFLCLWVYI
HM467770_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HM467769_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HM467765_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HE981176_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HE981175_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
HE981174_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
GU565217_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
GU563556_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
GQ325769_SHBs_P-G      XGPNLYNILSPFIPLLPIFFCXWVYI
GQ325770_SHBs_P-G      XGPNLYNILSPFIPLLPIFFCXWVYI
GQ325771_SHBs_P-G      XGPNLYNILSPFIPLLPIFFCXWVYI
GQ486843_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
EU366207_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
EU366208_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
EU366209_SHBs_P-G      WGPNLYNILSPFIPLLPIFFCLWVYI
FJ023936_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023968_SHBs_P-G      WGPSLYNILSPFLPLLPIFFCLWVYI
FJ358594_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023854_SHBs_P-G      WGPNLYNTLKPFIPLLPIFFCLWVYI
FJ023878_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023880_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023881_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023882_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023883_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FJ023884_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWGYI
FJ358587_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FR714503_SHBs_P-G      WGPSLYNILRPFIPLLPIFFCLWVYI
FR821984_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FR821987_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FR822110_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
FR822113_SHBs_P-G      WGPSLYNILSPFIPLLPIFFCLWVYI
                        ** *:    **: ****::      

© 1998-2022Legal notice