HBVdb

Dataset for protein MHBs of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

322 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB036906_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036907_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036908_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
KP995114_MHBs_P-F      MQWNSSKFHQHLLEPGVRALCLPAGGSSSGTQNPAPTIASLTSSIFSKTG
AB116654_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ638660_MHBs_P-F      MQWNTTQFHQALQDPRVRALLSPAGGSSSETQNPAPTIASLTSSIFXKTG
KJ638662_MHBs_P-F      MQWNTTQFHQALLDPXVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB116550_MHBs_P-F      MQWNSTQFHQALLDPKGKALYFPAGGSSSGTQNPAPTIASLTSSTFSKTG
JQ272888_MHBs_P-F      VKWNSAKFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSTTG
KP995118_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995117_MHBs_P-F      MQWNSTQFHQALLNPRVRALYFPAGGSSSGTQNPAPTIASLTSSTFSKTG
KJ638656_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KC494397_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995111_MHBs_P-F      MQWNSTQFHQALLDPKVTALYFPAGGSSSGTQNPAPTIASLTSSIFSTTG
HM622135_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ586805_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ586806_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ899150_MHBs_P-F      VQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467771_MHBs_P-F      ----STTFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467772_MHBs_P-F      ----STTFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
EF397990_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQGNARTIASLTSSIFSKTG
AB086397_MHBs_P-F      MQWNSTQFHQXLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN604271_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSSFSTTG
HM467761_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM101130_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM101125_MHBs_P-F      ----STQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLISSIFSKTG
HM101098_MHBs_P-F      ----STQFHQTLLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM101096_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM101097_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM585200_MHBs_P-F      MQWNSTLFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ657525_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KP995116_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KC494400_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585195_MHBs_P-F      MQWNATQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AF223964_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFHAGGSSSGTQNPAPTIASLTSSIFLKTG
AB064316_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709457_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709460_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AF223963_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843170_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843205_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AB116552_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AY090458_MHBs_C-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AY090459_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AY090461_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AY179735_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ823091_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ823092_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ823093_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ823094_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
DQ823095_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
EU366118_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ657529_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709458_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709459_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709462_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709463_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709464_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ709494_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585186_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585187_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585188_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585189_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585190_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585191_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585192_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585193_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585194_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585196_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585197_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585198_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM585199_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM590471_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM590472_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM590473_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HE981182_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HE981183_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ676694_MHBs_P-F      XQNNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
DQ899148_MHBs_P-F      MQWNSTQFHQALSDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467786_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467760_MHBs_P-F      ----STQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASPTSSIFLKTG
EF397987_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467784_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995097_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
FJ589066_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995101_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSPGTQNPVPTIASLTSSIFSKTG
HM467785_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
HM467762_MHBs_P-F      ----STQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFLKTG
X75663_MHBs_P-F        MQWNSTHFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTG
KP995113_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995110_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP718111_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFLKTG
AY311370_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
AY090455_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
AB036913_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036910_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSTFSKTG
DQ899142_MHBs_P-F      MQWNSTQFHQALLDPMVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTG
DQ899143_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KP995104_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995115_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995107_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995105_MHBs_P-F      IQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494399_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
AY311369_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
DQ131124_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
DQ899144_MHBs_P-F      MQWNSTQFHQALLDPRVKALYFPAGGSSSGTQNPAPTIASLTSSIYSKTG
DQ899145_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIYSKTG
EU159674_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494394_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494395_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494401_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494402_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494403_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KC494405_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KJ843191_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP718103_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995120_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KX264497_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
AB116549_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KJ638659_MHBs_P-F      XQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
AB036905_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036909_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036911_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036912_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036914_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036915_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036916_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036917_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036918_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036919_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
AB036920_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
DQ899149_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
KX264498_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPVPTIASLTSSIFSKTG
MH051987_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSRTG
KP995126_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995124_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995119_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995109_MHBs_P-F      MQWNSTQFHQALLDPRVRALSFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995106_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSGTQNPAPTIASLTSSIFSKTG
AB116551_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
FJ589067_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
JF439884_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTG
JF439885_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTG
MH051986_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995125_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP995123_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP718112_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP718109_MHBs_P-F      MQWNSTQFHQALLDPRVRALYSPAGGSSSGTQNPAPTIASLTSSIFSKTG
JN604211_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
KP718106_MHBs_P-F      XQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
MK183637_MHBs_P-F      MQWNSTQFHQALLDPRVRSLYFPAGGSSSETQNPAPTIASPTSSISSKTG
AY090456_MHBs_P-F      MQWNSSQFHQALLDPRVR----PAGGSSSETQNPAPTIASLTSSIFLKTG
MK183632_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASPTSSISSTTG
HM467783_MHBs_P-F      ----STLFHQTLLDPRVRDLYFPAGGSSSGTQNPAPTIASLTSSISLTTG
AB166850_MHBs_P-F      MQWNSTQFHQALLDPRVRALSPPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098584_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB365449_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098582_MHBs_P-F      MQWNSSEFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098583_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQSPAPTIASLTSSIFSKTG
KY476326_MHBs_P-F      MQWNSSQFHQALLDPRVRALYXPAGGSSSETQNPAPTIASLTSSISSKTG
KJ843185_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ638664_MHBs_P-F      IKWKWNTFHQALLDPKVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KC494396_MHBs_P-F      MQWNSTQFHQALLDPRVWALYFPAGGSSSGTQNPAPTIASLTSSIFPKTG
JN792917_MHBs_P-F      MQWNSTQFHQTLLDPRVRDLYLPAGGSSSETQNPAPTIASLTSSIFLKTG
JN604225_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
AB214516_MHBs_P-F      MQWNSTQFHQALLDPRVRALSPPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098580_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIVSLTSSIFSKTG
MG098574_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098564_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
JN688720_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSDTQNPAPTIASLTSSIFSKTG
DQ899147_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSRTQNPAPTIASLTSSIYSKTG
DQ899146_MHBs_P-F      MQWNSTQFHQALLDPRVKALYFPAGGSSSGTQNPAPTIASLTSSIYSKTG
AB365453_MHBs_P-F      MQWNSSQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSTTG
KJ843168_MHBs_P-F      MQWNSTQFHQTLLDPRVRA----AGGSSSETQNPAPTIVSLTSSIFLKTG
MG877712_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KY476329_MHBs_P-F      TQWNTPQFHQALLDPRVRALCFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476327_MHBs_P-F      VQWNSTQFHQALLDPRVRALYFPAGGSSSETQHPAPIIASLTSSIFLKTG
KT896494_MHBs_P-F      MQWNSTQFHQLLLDPRVRALCFPAGGSSSGTQNPAPTIASLTSSIFSTTG
KJ843225_MHBs_P-F      MQWNSIQFHQALLDQRVRTLCLPAGGSSSETQNPAPTIASLTSSIFSKTG
EF576808_MHBs_P-F      MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLISSISLTTG
MK183645_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASHTSSIFSKTG
MG098578_MHBs_P-F      MQWNSSEFHQALLDPRVRALYLPAGGSTSKTQNPAPTIASXTSSIFSNTG
KJ638657_MHBs_P-F      MQRNSTQFHQALLDPRVRALCVPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ586807_MHBs_P-F      MAWNSPQFHQGLLIPRVKGLLLVAGGSSSKTQNPAPTIASLTSSIFLKTG
EU670262_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPASGSSSETQNPAPTIASLTSSIFLKTG
DQ776247_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EU366116_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
FJ657519_MHBs_P-F      MQWNSTQFHQALLDPRVXALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
FJ657522_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843207_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843208_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843210_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843213_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
X75658_MHBs_C-F        MQWNSTHFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSISSKTG
MG098565_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KP718110_MHBs_P-F      MQWNSNQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSTFLXTG
KJ843220_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
FJ709465_MHBs_P-F      MQWNSTQFHQALLDPRVRTLYFPAGGSSSETQNPAPTIASLTSSIFLKTG
FJ657528_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EU366133_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFWKTG
DQ823087_MHBs_P-F      MQWNSAKFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183636_MHBs_P-F      IQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098575_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KY476324_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLTTG
KJ843169_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN688709_MHBs_P-F      MQWNSTQFHSTQLDPRVRALYXPAGGSSSETQNLAQTIASLXSSIFSKTG
EU366132_MHBs_P-F      MQWTSTQFHQALLDPRVRALYLXAGGSSSETQNPAPTIASLTSSIFSKTG
KY382411_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KX264499_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843226_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843224_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843222_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843221_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843219_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843212_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843211_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843209_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843189_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843175_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KC494398_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
JN811656_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
JN811655_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
JN688701_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
HE981181_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EF576812_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
DQ823090_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
DQ823088_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
DQ823086_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AF223965_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB365450_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AF223962_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183644_MHBs_P-F      MQWNSTQFHQALLDPKVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877715_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877703_MHBs_P-F      MQWNSTQFHRALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KP718113_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KP718104_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843223_MHBs_P-F      MQWNSTQFHQALLDPRVKALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KJ843163_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KF199901_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGCSSSETQNPAPTIASLTSSIFLKTG
JX079937_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
DQ823089_MHBs_P-F      MQWNSTQFHQVLLDPRVKALYYPAGGSSSETQNPAPTIASLTSSIFSKTG
AB365446_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877706_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877707_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877708_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG098566_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877704_MHBs_P-F      MQWNSTQFHXALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877705_MHBs_P-F      MQWNSTQFHXALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877722_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSXTG
MG877716_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877717_MHBs_P-F      MQWNSTQFHQALLDPRVRALYLPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183647_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183643_MHBs_P-F      MQWNSTQFHQALLDPKVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183641_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183640_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183639_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183638_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183633_MHBs_P-F      MQWNSTQFHQALLDPKVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183631_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK183630_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877714_MHBs_P-F      MQWNSTQFHQXLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MG877721_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFSKTG
MK058437_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
MG098569_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLXSSIFXKTG
KY476330_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476325_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843167_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN792922_MHBs_P-F      VQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN792918_MHBs_P-F      MQWNSTQFHQALLDPRVRDLYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN792920_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN792919_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN688703_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN688699_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN688691_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN604233_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
HM627320_MHBs_P-F      MQWNSTQFHQALXDPRVRXLYXPAGGSSSETQNPAPTIASLTSSIFLKTG
HQ378247_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KP718107_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843202_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843194_MHBs_P-F      MQWNSTQFHQTLLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
X69798_MHBs_P-F        MQWNSTQFHQALLDPRVRALYFPAGGSSSGTQNPAPTIASLTSSIFSKTG
MG877700_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476332_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476328_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476323_MHBs_P-F      MQWNSTQFHQALLAPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY476322_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY458062_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY458061_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KY382415_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTG
KY382416_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTG
KY382417_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFXKTG
OK106257_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIAXLTSSIFLKTG
KX264496_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KP995098_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KM998715_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KM233681_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843206_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843204_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843203_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843201_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843200_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843199_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843198_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843197_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843196_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843195_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843193_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843190_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843181_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843180_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843179_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843178_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843177_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843176_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843174_MHBs_P-F      MQWNSTQFHHALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843171_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ843164_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KJ586808_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
KF779236_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSGTVNPAPTIASLTSSIFLKTG
KC494404_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
JN792921_MHBs_P-F      MQWNSTQFHQXLLBPRVRALYFPAGGSSSXTQNPAPTIASLTSSIFLKTG
JX079936_MHBs_P-F      MQWNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTG
                              **              *. *:. *   .  *.   **    **

AB036906_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036907_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036908_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995114_MHBs_P-F      GPAMNMDNITSGLLRPLLVLQAVSFLLTKIRTIPQSLDSWWTSLNFLGGL
AB116654_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVFSLLTKILTIPQSLDSWWTSLNFLGGT
KJ638660_MHBs_P-F      GPVMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ638662_MHBs_P-F      GPVMNMDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSRNFLGEI
AB116550_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JQ272888_MHBs_P-F      DLAMNMDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGEL
KP995118_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995117_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILKIPQSLDSWWTSLNFLGGL
KJ638656_MHBs_P-F      GPAMNMDNTTSGHLGLLLVLQAVCFLLTKILKIPQNLDSWWTSLNFLGGT
KC494397_MHBs_P-F      GPAMNMDNTYSGLLRPLLVSQAVCSLLTKILTIPQSLDSWWTSLNFLGGL
KP995111_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGGL
HM622135_MHBs_P-F      GPATNMDNITSGHLGPLLVLQAVCSLLTKIRTIPQSLDSWWTSLNFLGGT
KJ586805_MHBs_P-F      GPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ586806_MHBs_P-F      GPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ899150_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM467771_MHBs_P-F      GPAMNMENIISGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM467772_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
EF397990_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGGL
AB086397_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAAFFLLIKILTIPRSLDSWWTSLNFLGET
JN604271_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLIKILTIPRSLDSWWTSLNFLGET
HM467761_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM101130_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM101125_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM101098_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM101096_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGGL
HM101097_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM585200_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ657525_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLSFLGGT
KP995116_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KC494400_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGRT
HM585195_MHBs_P-F      GLATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AF223964_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AB064316_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709457_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709460_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AF223963_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843170_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843205_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AB116552_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AY090458_MHBs_C-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AY090459_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AY090461_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
AY179735_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGT
DQ823091_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ823092_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ823093_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ823094_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ823095_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
EU366118_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ657529_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709458_MHBs_P-F      GLATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGT
FJ709459_MHBs_P-F      GLATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709462_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709463_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709464_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ709494_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585186_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585187_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585188_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585189_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585190_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585191_MHBs_P-F      GLATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585192_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585193_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585194_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585196_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585197_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585198_MHBs_P-F      GLATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM585199_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM590471_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM590472_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM590473_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HE981182_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HE981183_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ676694_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSLNFLGEL
DQ899148_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM467786_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM467760_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGDL
EF397987_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGAL
HM467784_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGP
KP995097_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTMPQSLDLWWTSLSFLEGL
FJ589066_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLEGL
KP995101_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGEL
HM467785_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HM467762_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGL
X75663_MHBs_P-F        GPAMNMENITSGLLGPLRVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995113_MHBs_P-F      GPAMNMDNITSKLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGGL
KP995110_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP718111_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AY311370_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAGGFLLTKILTIPQSLDSWWTSLNFLGGL
AY090455_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036913_MHBs_P-F      GPAMNMENITSGLXGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036910_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899142_MHBs_P-F      GPAMSMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899143_MHBs_P-F      GPAMSMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995104_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995115_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGL
KP995107_MHBs_P-F      GPAMNMDNTTSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995105_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGAL
KC494399_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVYFLLIKILIMPQSLDSWWTSLNFLGGL
AY311369_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ131124_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899144_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899145_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
EU159674_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494394_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494395_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494401_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494402_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494403_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494405_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843191_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP718103_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995120_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KX264497_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB116549_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ638659_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLXKILTIPQSLDSWWTSLNFLGGL
AB036905_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036909_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036911_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036912_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036914_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036915_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036916_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036917_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036918_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036919_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB036920_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899149_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KX264498_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MH051987_MHBs_P-F      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995126_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995124_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995119_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995109_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGL
KP995106_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB116551_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
FJ589067_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JF439884_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JF439885_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MH051986_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995125_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP995123_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP718112_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP718109_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JN604211_MHBs_P-F      GPALNMENITSGLLGPLLVLQAVFFLLTKILTIPXXLDSWWTSLNFLGGL
KP718106_MHBs_P-F      GPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183637_MHBs_P-F      GPAMNMDSTTSGLLGPLPVLRAVCSLLTKIRRIPQSLDSWWISLNFLGGL
AY090456_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
MK183632_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSRNFLGEL
HM467783_MHBs_P-F      GPATNMENITSGLLGPLLVLQAVFFLLIKILTIPQSLDSWWTSLNFLGGL
AB166850_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDLWWTSLNFLGGL
MG098584_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLSFLGGL
AB365449_MHBs_P-F      GPAMNMDNITSGLXGPLLVLQAVCFLWTKILKTPQSLDSWWTSLNFLGAL
MG098582_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGL
MG098583_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGAL
KY476326_MHBs_P-F      GPAMNMDNITSGLLGPLLVLXAVCFWLTKIRKIPQSLDSWWTSLNFLGGP
KJ843185_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ638664_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFLLTKILTIPQSLDSWWTSLNFLGGP
KC494396_MHBs_P-F      GPAMNMDNITSGLLGPLLVLHAVCFLLTKILTMPQSLDSWWTSLNFLGGL
JN792917_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTSFLTIPQSLDSWWTSLNFLGGT
JN604225_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGET
AB214516_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG098580_MHBs_P-F      GPVMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG098574_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG098564_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JN688720_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVFFSLIKIRTIPQSLDSWWTSLNFLGEL
DQ899147_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ899146_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB365453_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843168_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
MG877712_MHBs_P-F      DPAMNMDNITSGLLGPLLVLQAAFFLLTKILTMPQSLDSWWTSLNFLGGL
KY476329_MHBs_P-F      APATNMDNISSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGT
KY476327_MHBs_P-F      APATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQNLDSWWTSLNFLGGT
KT896494_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843225_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVYFLLIKILTIPQNLDSWWTSLNFLGGL
EF576808_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGL
MK183645_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGL
MG098578_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCILLIKILTIPQSLDSWWTSLNFLGGL
KJ638657_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPXSLDSWWTSLNFLGGT
KJ586807_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLNSWWTSLNFLGGT
EU670262_MHBs_P-F      APATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ776247_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
EU366116_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
FJ657519_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
FJ657522_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843207_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843208_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843210_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843213_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
X75658_MHBs_C-F        GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG098565_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGL
KP718110_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGT
KJ843220_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
FJ709465_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
FJ657528_MHBs_P-F      GPAMTMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
EU366133_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
DQ823087_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183636_MHBs_P-F      GPAINIDNITSGLLKPLLMLQAVYFLLTKILTIPQSLDSWWTSLNFLGGL
MG098575_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGL
KY476324_MHBs_P-F      APATNMDNITSGLLGPLLVLQAVFFLLTKILTIPKSLDSWWTSLNFLGGT
KJ843169_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN688709_MHBs_P-F      GXAMNMDNITSGLLGPLLVLQGVFFLLTKILTIPQSLDSWWTSLNFLGGL
EU366132_MHBs_P-F      GPAMNMDNITSGLLRPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGL
KY382411_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KX264499_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843226_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843224_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843222_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843221_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843219_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843212_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843211_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843209_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843189_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KJ843175_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KC494398_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JN811656_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JN811655_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
JN688701_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGL
HE981181_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
EF576812_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ823090_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ823088_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ823086_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AF223965_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB365450_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AF223962_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183644_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG877715_MHBs_P-F      GPAMNMDNITSGLLGPLLXLQAVFFLLTKILTIPQSLDSWWTSLNFLGGP
MG877703_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
KP718113_MHBs_P-F      APAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KP718104_MHBs_P-F      APAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843223_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKIXTIPQSLDSWWTSLNFLGGL
KJ843163_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KF199901_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JX079937_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
DQ823089_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
AB365446_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGAL
MG877706_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGEL
MG877707_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGEL
MG877708_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGEL
MG098566_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDXXWTSLXFLGEL
MG877704_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXL
MG877705_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXL
MG877722_MHBs_P-F      GPAMNMDTITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGAL
MG877716_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGXP
MG877717_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVFFLLTKILTIPQXLDSWWTSLNFLGXP
MK183647_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183643_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183641_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183640_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183639_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183638_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183633_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK183631_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGL
MK183630_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG877714_MHBs_P-F      GPAMNMDNITSGLLGPLLVXQAXFFLLTKILTIPQSLDSWWTSLNFLGGL
MG877721_MHBs_P-F      GPAMNMDTITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MK058437_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
MG098569_MHBs_P-F      GPAMNMDSITSGLLGPLLVLQAVCFLLTKILTXPQSLDSWWTSLSFLEGL
KY476330_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFSLTKILTIPQSLDSWWTSRNFLGET
KY476325_MHBs_P-F      GPATNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843167_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN792922_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN792918_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGT
JN792920_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN792919_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN688703_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN688699_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN688691_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN604233_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HM627320_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
HQ378247_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KP718107_MHBs_P-F      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843202_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843194_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
X69798_MHBs_P-F        GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
MG877700_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY476332_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY476328_MHBs_P-F      GPATNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY476323_MHBs_P-F      GPATNMDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY476322_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY458062_MHBs_P-F      GPATNMDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY458061_MHBs_P-F      GPATNMDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY382415_MHBs_P-F      GPAXNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY382416_MHBs_P-F      GPAXNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KY382417_MHBs_P-F      GPAXNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
OK106257_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KX264496_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KP995098_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KM998715_MHBs_P-F      GPATNMDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KM233681_MHBs_P-F      GPAVNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843206_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843204_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843203_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843201_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843200_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843199_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843198_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843197_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843196_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843195_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843193_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843190_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843181_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843180_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843179_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843178_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843177_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843176_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843174_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843171_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ843164_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KJ586808_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KF779236_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
KC494404_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
JN792921_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGX
JX079936_MHBs_P-F      GPATNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGT
                         . .::.  *     *    .       :   *  *:  * *  **   

AB036906_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036907_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036908_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995114_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWTCLRRFIIFLFILLLCLIFLL
AB116654_MHBs_P-F      TGCPGQNSLSPTSNHLPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLL
KJ638660_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ638662_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB116550_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ272888_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995118_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
KP995117_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ638656_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494397_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCRRRFIIFLFILLLCLIFLL
KP995111_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM622135_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586805_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586806_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899150_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467771_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467772_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF397990_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB086397_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604271_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467761_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM101130_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM101125_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM101098_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM101096_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM101097_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585200_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ657525_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995116_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494400_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585195_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF223964_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB064316_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709457_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709460_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF223963_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843170_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843205_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB116552_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090458_MHBs_C-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090459_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090461_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY179735_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823091_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823092_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823093_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823094_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823095_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU366118_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ657529_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709458_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709459_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709462_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709463_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709464_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709494_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585186_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585187_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585188_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585189_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585190_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585191_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585192_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585193_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585194_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585196_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585197_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585198_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM585199_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM590471_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM590472_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM590473_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981182_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981183_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ676694_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899148_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467786_MHBs_P-F      PECPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467760_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF397987_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467784_MHBs_P-F      HGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995097_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ589066_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995101_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467785_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467762_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X75663_MHBs_P-F        PRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995113_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995110_MHBs_P-F      PGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718111_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY311370_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090455_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036913_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036910_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899142_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899143_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995104_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
KP995115_MHBs_P-F      PVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995107_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995105_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494399_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY311369_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ131124_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899144_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899145_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU159674_MHBs_P-F      PGCSGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494394_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494395_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494401_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494402_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494403_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494405_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843191_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718103_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995120_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264497_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB116549_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ638659_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036905_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036909_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036911_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036912_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036914_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036915_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036916_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036917_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036918_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036919_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB036920_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899149_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264498_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH051987_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995126_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995124_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995119_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KP995109_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995106_MHBs_P-F      PGCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB116551_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ589067_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439884_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439885_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH051986_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995125_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995123_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718112_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718109_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604211_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718106_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183637_MHBs_P-F      PGCPGQNSQSPTSNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090456_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183632_MHBs_P-F      PXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM467783_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB166850_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098584_MHBs_P-F      PECPGQNSQSPTSNHLPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
AB365449_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098582_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098583_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWXCLRRFIIFLFILLLCLIFLL
KY476326_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843185_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ638664_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494396_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792917_MHBs_P-F      PGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604225_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLL
AB214516_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098580_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098574_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCHGYRWMCLRRFIIFLFILLLCLIFLL
MG098564_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688720_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ899147_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLQCLIFLL
DQ899146_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLPRFIIFLFILLLCLIFLL
AB365453_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843168_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877712_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476329_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476327_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT896494_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843225_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF576808_MHBs_P-F      PRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183645_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098578_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ638657_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586807_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU670262_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ776247_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU366116_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ657519_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ657522_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843207_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843208_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843210_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843213_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X75658_MHBs_C-F        PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098565_MHBs_P-F      PGCPXQNSQSPTSNHLPTSCPXTCPVYRWMCLRRFIIFLFILLLCLIFLL
KP718110_MHBs_P-F      PGCPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843220_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ709465_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ657528_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU366133_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823087_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183636_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098575_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476324_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843169_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688709_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU366132_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPLTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY382411_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264499_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843226_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843224_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843222_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843221_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843219_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843212_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843211_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843209_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843189_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843175_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494398_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN811656_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN811655_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688701_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981181_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF576812_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823090_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823088_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823086_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF223965_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB365450_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF223962_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183644_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877715_MHBs_P-F      PXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877703_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718113_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718104_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843223_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843163_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF199901_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX079937_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ823089_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB365446_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877706_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877707_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877708_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098566_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877704_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877705_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877722_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877716_MHBs_P-F      PXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877717_MHBs_P-F      PXCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183647_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183643_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183641_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183640_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183639_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183638_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183633_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183631_MHBs_P-F      PGCPGQNXQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK183630_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877714_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877721_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK058437_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG098569_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPXYRWMCLRRFIIFLFILLLCLIFLL
KY476330_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476325_MHBs_P-F      PGCPGQNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843167_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792922_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792918_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792920_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792919_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688703_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688699_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688691_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604233_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM627320_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ378247_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP718107_MHBs_P-F      PGCPGQNSQSPTSNHLXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843202_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843194_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X69798_MHBs_P-F        PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG877700_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476332_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476328_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476323_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY476322_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY458062_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY458061_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY382415_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY382416_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY382417_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
OK106257_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264496_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995098_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM998715_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM233681_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843206_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843204_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843203_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843201_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843200_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843199_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843198_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843197_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843196_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843195_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843193_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843190_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843181_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843180_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843179_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843178_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843177_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843176_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843174_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843171_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843164_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586808_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779236_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC494404_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN792921_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX079936_MHBs_P-F      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
                         *  **  ******* * ** **  **     * **** *** ** ***

AB036906_MHBs_P-F      VLLDYQGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036907_MHBs_P-F      VLLDYQGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036908_MHBs_P-F      VLLDYQGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995114_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB116654_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ638660_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ638662_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB116550_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
JQ272888_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995118_MHBs_P-F      VLLDYHGILPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995117_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTPLAQGTSMFPSCCCSKPSDG
KJ638656_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSRPSDG
KC494397_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMVPSCCCSKPSDG
KP995111_MHBs_P-F      VLVDSQGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
HM622135_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ586805_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ586806_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899150_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467771_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467772_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EF397990_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB086397_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN604271_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467761_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM101130_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
HM101125_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM101098_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM101096_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM101097_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585200_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ657525_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995116_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494400_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585195_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AF223964_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB064316_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709457_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709460_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AF223963_MHBs_P-F      VLVDYQGMLPVCPPLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843170_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843205_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB116552_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY090458_MHBs_C-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY090459_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY090461_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY179735_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823091_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823092_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823093_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823094_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823095_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EU366118_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ657529_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709458_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709459_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709462_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709463_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709464_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709494_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585186_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585187_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585188_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585189_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585190_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585191_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585192_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585193_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585194_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585196_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585197_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585198_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM585199_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM590471_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM590472_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM590473_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HE981182_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HE981183_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ676694_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
DQ899148_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467786_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467760_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EF397987_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467784_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995097_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ589066_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995101_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467785_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM467762_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
X75663_MHBs_P-F        VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDG
KP995113_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KP995110_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDG
KP718111_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY311370_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY090455_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036913_MHBs_P-F      VLVDYRGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036910_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899142_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
DQ899143_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KP995104_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KP995115_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KP995107_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995105_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494399_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY311369_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ131124_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899144_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899145_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EU159674_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494394_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494395_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494401_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494402_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494403_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494405_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843191_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718103_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995120_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KX264497_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB116549_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ638659_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036905_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036909_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036911_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036912_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036914_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036915_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036916_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036917_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036918_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036919_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB036920_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899149_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KX264498_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MH051987_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995126_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KP995124_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KP995119_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995109_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995106_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB116551_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ589067_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JF439884_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JF439885_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MH051986_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995125_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995123_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718112_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718109_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN604211_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718106_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183637_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AY090456_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDG
MK183632_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMLPSCCCTKPSDG
HM467783_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB166850_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098584_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB365449_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCNTCTTLAQGTSMFPSCCCSKPSDG
MG098582_MHBs_P-F      VLVDYQGMLPVCPLIPGSTTTSTGXCKTCTTLAQGTSMFPSCCCSKPSDG
MG098583_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTITGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476326_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQETSMFPSCCCSKPSDG
KJ843185_MHBs_P-F      VLVDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KJ638664_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494396_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792917_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN604225_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB214516_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098580_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098574_MHBs_P-F      VLVDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098564_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688720_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ899147_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQRTSMFPSCCCSKPSDG
DQ899146_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB365453_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843168_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877712_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476329_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476327_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KT896494_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843225_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EF576808_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183645_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098578_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ638657_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDG
KJ586807_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EU670262_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ776247_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
EU366116_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
FJ657519_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
FJ657522_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KJ843207_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KJ843208_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KJ843210_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KJ843213_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
X75658_MHBs_C-F        VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098565_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718110_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843220_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ709465_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
FJ657528_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EU366133_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823087_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183636_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG098575_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476324_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843169_MHBs_P-F      VLVDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688709_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EU366132_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY382411_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KX264499_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843226_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKXCTTLAQGTSMFPSCCCSKPSDG
KJ843224_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843222_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843221_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843219_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843212_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843211_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843209_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843189_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843175_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494398_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN811656_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN811655_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688701_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HE981181_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
EF576812_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823090_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823088_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823086_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AF223965_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB365450_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTXMFPSCCCSKPSDG
AF223962_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183644_MHBs_P-F      VLLDYQGMLPVCPLIPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877715_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877703_MHBs_P-F      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718113_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718104_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843223_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843163_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KF199901_MHBs_P-F      VLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JX079937_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
DQ823089_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
AB365446_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877706_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDG
MG877707_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDG
MG877708_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDG
MG098566_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877704_MHBs_P-F      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877705_MHBs_P-F      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877722_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877716_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877717_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183647_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183643_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183641_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183640_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183639_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183638_MHBs_P-F      VLLDYQGXLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183633_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183631_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK183630_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877714_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877721_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MK058437_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEG
MG098569_MHBs_P-F      VLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476330_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476325_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843167_MHBs_P-F      VLLDYQGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792922_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792918_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792920_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792919_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688703_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688699_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN688691_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN604233_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HM627320_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
HQ378247_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP718107_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843202_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843194_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
X69798_MHBs_P-F        VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
MG877700_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476332_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476328_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476323_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY476322_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY458062_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY458061_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY382415_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY382416_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KY382417_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
OK106257_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KX264496_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KP995098_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KM998715_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KM233681_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843206_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843204_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843203_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLALGTSMFPSCCCSKPSDG
KJ843201_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843200_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843199_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843198_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843197_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843196_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843195_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843193_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843190_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843181_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843180_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843179_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843178_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843177_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843176_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843174_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843171_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ843164_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KJ586808_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KF779236_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
KC494404_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JN792921_MHBs_P-F      VLLDYQGMLPVCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
JX079936_MHBs_P-F      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDG
                       **:* .* *****   *   * ** *. **. *  * *.*****:.**:*

AB036906_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036907_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036908_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995114_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLAI
AB116654_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ638660_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
KJ638662_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
AB116550_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
JQ272888_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
KP995118_MHBs_P-F      NCTCIPIPSSWALGKFLWGWASARFSWLSLLVQFVQWCVELSPTVWLLVI
KP995117_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVI
KJ638656_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494397_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995111_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM622135_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ586805_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ586806_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899150_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467771_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467772_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
EF397990_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB086397_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN604271_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467761_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM101130_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM101125_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM101098_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM101096_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSVI
HM101097_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585200_MHBs_P-F      NCTCIPIPSSWALGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
FJ657525_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995116_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
KC494400_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585195_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AF223964_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB064316_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709457_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
FJ709460_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AF223963_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843170_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843205_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB116552_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090458_MHBs_C-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090459_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090461_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY179735_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823091_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823092_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823093_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823094_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823095_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU366118_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ657529_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709458_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709459_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709462_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
FJ709463_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709464_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ709494_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585186_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585187_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585188_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585189_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585190_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585191_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585192_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585193_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585194_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585196_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585197_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585198_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM585199_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM590471_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM590472_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM590473_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HE981182_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVI
HE981183_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVI
KJ676694_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899148_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467786_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467760_MHBs_P-F      NCTCIPIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVI
EF397987_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFYWLSLLVQFVQWCVGLSPTVWLLVI
HM467784_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995097_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ589066_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995101_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467785_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
HM467762_MHBs_P-F      NCTCIPIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVI
X75663_MHBs_P-F        NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995113_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995110_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718111_MHBs_P-F      NCTCIPIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY311370_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090455_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVI
AB036913_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036910_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899142_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899143_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995104_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995115_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995107_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995105_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494399_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY311369_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ131124_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899144_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899145_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU159674_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494394_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494395_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494401_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
KC494402_MHBs_P-F      NCTCIPIPSSWALGKFLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494403_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494405_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843191_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718103_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995120_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
KX264497_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB116549_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
KJ638659_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
AB036905_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036909_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036911_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036912_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036914_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036915_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036916_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036917_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036918_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036919_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB036920_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899149_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KX264498_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MH051987_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995126_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995124_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995119_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995109_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995106_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB116551_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ589067_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JF439884_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JF439885_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MH051986_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995125_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995123_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718112_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718109_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN604211_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718106_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASAXFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183637_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090456_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183632_MHBs_P-F      NCTCIPIPSSLALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM467783_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB166850_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098584_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVI
AB365449_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098582_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098583_MHBs_P-F      NCTCIPIPSSWALGXYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476326_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843185_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ638664_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494396_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792917_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN604225_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB214516_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLII
MG098580_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098574_MHBs_P-F      NCTCIPIPSSWXLGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098564_MHBs_P-F      NCTCIPIPSSRALGKYLWECASARFSWLILLVQFVQWCVGFSPTVWLLVI
JN688720_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ899147_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
DQ899146_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
AB365453_MHBs_P-F      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843168_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877712_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476329_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476327_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KT896494_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843225_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EF576808_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183645_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098578_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ638657_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ586807_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU670262_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ776247_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU366116_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ657519_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ657522_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843207_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843208_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843210_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843213_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
X75658_MHBs_C-F        NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098565_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQCCVGLSPTVWLLVI
KP718110_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843220_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVI
FJ709465_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ657528_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU366133_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823087_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183636_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098575_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASXRFSWLNLLVQFVQWCEGLSPIVWLLVI
KY476324_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843169_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN688709_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU366132_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLVI
KY382411_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KX264499_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843226_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843224_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843222_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843221_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843219_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843212_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843211_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843209_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843189_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843175_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494398_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN811656_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN811655_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN688701_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HE981181_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EF576812_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823090_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823088_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823086_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AF223965_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB365450_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AF223962_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183644_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877715_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPXVWLLVI
MG877703_MHBs_P-F      NCTCIPIPSSLALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718113_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718104_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843223_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843163_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVRFVQWCVGLSPTVWLLVI
KF199901_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVI
JX079937_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
DQ823089_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB365446_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877706_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWXLXX
MG877707_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWXXXX
MG877708_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWXXXI
MG098566_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877704_MHBs_P-F      NCTCIPIPSSXALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877705_MHBs_P-F      NCTCIPIPSSXALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877722_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877716_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPXVWLLVI
MG877717_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWXVGLSPXVWLLVI
MK183647_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183643_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183641_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183640_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183639_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183638_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183633_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK183631_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLMQFVQWCVGLSPTVWLSVI
MK183630_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877714_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877721_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MK058437_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG098569_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476330_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476325_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843167_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792922_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792918_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792920_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792919_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN688703_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN688699_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN688691_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN604233_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM627320_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HQ378247_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP718107_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843202_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVELSPTVWLLVI
KJ843194_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
X69798_MHBs_P-F        NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
MG877700_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476332_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476328_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476323_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY476322_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY458062_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY458061_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KY382415_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVI
KY382416_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVI
KY382417_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVI
OK106257_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVI
KX264496_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KP995098_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KM998715_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KM233681_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843206_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843204_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843203_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843201_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843200_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843199_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843198_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843197_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843196_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843195_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843193_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843190_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843181_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843180_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843179_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843178_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843177_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843176_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843174_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843171_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ843164_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KJ586808_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KF779236_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KC494404_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN792921_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JX079936_MHBs_P-F      NCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
                       **********  :* :**  .*  * ** **: ***    :** **    

AB036906_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036907_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036908_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995114_MHBs_P-F      WMIWYWGPNLFSILSPFIPLLPIFCYLWVSI
AB116654_MHBs_P-F      WMIWYWGPNLCSILSPFTLLLLIFCYLWVSS
KJ638660_MHBs_P-F      WMIWYWGPXLCXILSPFIPLLPIFCYLWVSI
KJ638662_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB116550_MHBs_P-F      WMIWYWGPNLRNILSPFIPLLPIFCYLWVSI
JQ272888_MHBs_P-F      WMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
KP995118_MHBs_P-F      LMIWYWGPNLCSILSHFIPLLPIFWYLWVSI
KP995117_MHBs_P-F      WMIWYWGPNLHSILSPFIPLLPIFCYLWGSI
KJ638656_MHBs_P-F      WMIWYWGPNLGSILSHFIPLLPIFCYLWGSI
KC494397_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995111_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWGSI
HM622135_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ586805_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ586806_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899150_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYRWVSI
HM467771_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467772_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EF397990_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB086397_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN604271_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467761_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM101130_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM101125_MHBs_P-F      WMIWYWGPNLCSTLSPFIPLLPIFCYLWVSI
HM101098_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM101096_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
HM101097_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
HM585200_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ657525_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995116_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFWYLWVSI
KC494400_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585195_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AF223964_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB064316_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709457_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709460_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AF223963_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843170_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843205_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB116552_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY090458_MHBs_C-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY090459_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY090461_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY179735_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823091_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823092_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823093_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823094_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823095_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EU366118_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ657529_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709458_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709459_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709462_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709463_MHBs_P-F      WMIWYWGPNLCSILSPFXPLLPIFCYLWVSI
FJ709464_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709494_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585186_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585187_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585188_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585189_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585190_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585191_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585192_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585193_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585194_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585196_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585197_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585198_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM585199_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM590471_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM590472_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM590473_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HE981182_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HE981183_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ676694_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899148_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467786_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467760_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EF397987_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467784_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995097_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ589066_MHBs_P-F      WMIWYWGPNLCSTLRPFIPLLPIFCYLWVSI
KP995101_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467785_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467762_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
X75663_MHBs_P-F        WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995113_MHBs_P-F      WMIWYWGPNLCSILSPFIPLFLIFCYLWVSI
KP995110_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718111_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY311370_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY090455_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036913_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036910_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899142_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899143_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995104_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995115_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KP995107_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995105_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494399_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY311369_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ131124_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899144_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899145_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EU159674_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494394_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494395_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494401_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494402_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494403_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494405_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843191_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718103_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995120_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KX264497_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB116549_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ638659_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036905_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036909_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036911_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036912_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036914_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036915_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036916_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036917_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036918_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036919_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB036920_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899149_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KX264498_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MH051987_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995126_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995124_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995119_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995109_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995106_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
AB116551_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ589067_MHBs_P-F      WMIWYWGPNLCRILSPFIPLLPIFCYLWVSI
JF439884_MHBs_P-F      WMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
JF439885_MHBs_P-F      WMIWYWGPNRCSILSPFIPLLPIFCYLWVSI
MH051986_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995125_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995123_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718112_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718109_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN604211_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KP718106_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183637_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AY090456_MHBs_P-F      WMIWYWGQNLCSILSPFIPLLPIFCYLWVSS
MK183632_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM467783_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB166850_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098584_MHBs_P-F      WMIWYWGPNLFTTLSPFIPLLPIFCYLWVSI
AB365449_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098582_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098583_MHBs_P-F      WMIWYWGPNLCNILKPFIPLLPIFCYLWVSI
KY476326_MHBs_P-F      WMIWYWGPNLSSILSPFIPLLPIFCYLWVSI
KJ843185_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ638664_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI
KC494396_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792917_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN604225_MHBs_P-F      WMIWYWGLNLCSILSPFIPLLPIFCYLWVSI
AB214516_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098580_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098574_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098564_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN688720_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899147_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ899146_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB365453_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KJ843168_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877712_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476329_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476327_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KT896494_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843225_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
EF576808_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183645_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098578_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ638657_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ586807_MHBs_P-F      WMIWYWGPNLCSILSPFMPLLPIFCYLWVSI
EU670262_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ776247_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EU366116_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ657519_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ657522_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843207_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KJ843208_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843210_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843213_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
X75658_MHBs_C-F        WMIWYWEPNLCSILSPFIPLLPIFCYLWVSI
MG098565_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718110_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843220_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ709465_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
FJ657528_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EU366133_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823087_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183636_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098575_MHBs_P-F      WMIWYWGPNLCSILSPXIPLLPIFCYLWVSI
KY476324_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KJ843169_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN688709_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EU366132_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY382411_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KX264499_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843226_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843224_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843222_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843221_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843219_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843212_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843211_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843209_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843189_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843175_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494398_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN811656_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN811655_MHBs_P-F      WMIWYWGPNLCSIVSPFIPLLPIFCYLWVSI
JN688701_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HE981181_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
EF576812_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823090_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823088_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
DQ823086_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AF223965_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB365450_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
AF223962_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183644_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877715_MHBs_P-F      WMIWYWGPNLFNILSPFIPLLPIFCYLWVSI
MG877703_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718113_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718104_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843223_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSN
KJ843163_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KF199901_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JX079937_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFSYLWVSI
DQ823089_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
AB365446_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877706_MHBs_P-F      WMIWYWGPKLCXILSPFIPLLPIFCYLWVSI
MG877707_MHBs_P-F      WMIWYWGPKLXSILSPFIPLLPIFCYLWVSI
MG877708_MHBs_P-F      WMIWYWGPKLYSILSPFIPLLPIFCYLWVSI
MG098566_MHBs_P-F      WMIWYWGPNLCSIWSRFIPLLPIFCYLWVSI
MG877704_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877705_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877722_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877716_MHBs_P-F      WMIWYWGPNLFNILSPFIPLLPIFCYLWVSI
MG877717_MHBs_P-F      WMIWYWGPNLXNILSPFIPLLPIFCYLWVSI
MK183647_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183643_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183641_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183640_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183639_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183638_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183633_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MK183631_MHBs_P-F      WMIWYWGPNLCSIWSPFIPLLPIFCYLWVSI
MK183630_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877714_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877721_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWXSI
MK058437_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG098569_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KY476330_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476325_MHBs_P-F      WMIWYWGPNLCSIWSPFIPLLPIFCYLWVSI
KJ843167_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792922_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792918_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792920_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792919_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN688703_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN688699_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN688691_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN604233_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HM627320_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
HQ378247_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP718107_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843202_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843194_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
X69798_MHBs_P-F        WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
MG877700_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476332_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476328_MHBs_P-F      WMIWYWGPNLCNILSPFIPLLPIFCYLWVSI
KY476323_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY476322_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY458062_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY458061_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY382415_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY382416_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KY382417_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
OK106257_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KX264496_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KP995098_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KM998715_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KM233681_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843206_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843204_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843203_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843201_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843200_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843199_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843198_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843197_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843196_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843195_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843193_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843190_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843181_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843180_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843179_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843178_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843177_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843176_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843174_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843171_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ843164_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KJ586808_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KF779236_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
KC494404_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JN792921_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
JX079936_MHBs_P-F      WMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
                        *****             *: ** * * * 

© 1998-2022Legal notice