HBVdb

Dataset for protein HBc of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

318 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC494399_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLIDTASALYRDALESPEHCSP
MG098583_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDSLESPEHCSP
MG098574_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098577_HBc_P-F      MDIDPYKEFGASVELLSFLPNDFFPSARDLLDTASALYRDALESPEHCTP
MG098569_HBc_P-F      MDIDPYKEFGASVELLSFLPHDFYPSIRDLLDTAAALFRDALESPEHCTP
KY476330_HBc_P-F      MDIDPYKEYGASAELLSFLPTDFYPSVRDLLDTAQALFRDALESPEHCTP
KP995115_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP995101_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MG098566_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTH
JN792919_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098573_HBc_P-F      MDIDPYKEFGASVELLSFLPIDFFPSARDLLDTASALYRDALESPEHCSP
KJ676694_HBc_P-F      MDIDPYKEFGASLELLSFLPSDFYPSVRDLIDTASALYRDALESPEHCTP
KJ638660_HBc_P-F      MDIDPYKEFGASLELLSFLPXDFFPSXRDLIDTASALYRDALESPEHCTP
MG877708_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KY476329_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
KY476326_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP995111_HBc_P-F      MDIDPYKEFGASVELLSFLPIDFFPSVRDLLDTATALYRDALESPEHCTP
KC494400_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ589067_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KT896494_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCTP
KP718110_HBc_P-F      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSH
JN688709_HBc_P-F      MDIDPYKEFGASVELXSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
MK183637_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG877703_HBc_P-F      MDIDPYKEFGASRELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098579_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAXALFKDALESPEHCTP
KJ843195_HBc_P-F      MDIDPYKEFGASLELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ586808_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCTP
KC494394_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995119_HBc_P-F      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTP
KP995095_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843167_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB365446_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYRDALESPEHCTP
KJ586807_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ586806_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KF199901_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494405_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494404_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494403_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494402_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494401_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494398_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494397_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC494395_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX079937_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX079936_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN811656_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN811655_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN792922_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN688703_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN688699_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183644_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCTP
MK183633_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCTP
MK183638_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCTP
MK183643_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183630_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183641_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183635_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183636_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183639_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ638662_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995109_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995105_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRQALESPEHCTP
KJ843225_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN792920_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MH051987_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098565_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY476327_HBc_P-F      MDIDPYKEFGASVELLSFLPLDFFPSVRDLLDTASALYRDALESPEHCTP
KX757672_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995106_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718107_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843194_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843191_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCTP
KJ843169_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843168_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ638659_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995096_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718113_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718104_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098570_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYRDALESPEHCTP
KY476331_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995107_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP718109_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
X75663_HBc_P-F        MDIDPYKEFGASVELFSFLASDFFPSVRDLLDTASALYRDALESPEHCTP
X75658_HBc_C-F        MDIDPYKEFGASVELFSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
X69798_HBc_P-F        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183647_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183640_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK058437_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MH051986_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098564_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLXTASALYRDALESPEHCTP
KY476332_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY476324_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTP
KY476323_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY476322_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY458062_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY458061_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY382411_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX757665_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX264499_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX264498_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX264497_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX264496_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995126_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995125_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995124_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995123_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995120_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995118_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995116_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995110_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995104_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995098_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995091_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718112_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718111_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718103_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KM998715_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KM233681_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843226_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843224_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843223_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843222_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843221_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843220_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843219_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843213_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843212_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843211_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843210_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843209_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843208_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843207_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843206_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843205_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843204_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843203_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843202_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843201_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843200_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843199_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843198_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASPLYRDALESPEHCTP
KJ843197_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843196_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843193_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843190_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843189_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843185_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843181_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843180_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843179_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843178_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843177_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843176_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843175_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843174_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843171_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843170_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843164_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ843163_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
OK106257_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995117_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ638657_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY382417_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KY382416_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP718106_HBc_P-F      MDIDXYKEFGASXELLSFLPSDFFPSXRDLLDTASALYRDALESPEHCTP
KY382415_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MK183632_HBc_P-F      MDIDPFKEFGASWELLSFLPHDFYPSVRDLLDTASALYRDALESPEHCSP
MK183631_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ657525_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSP
MG877700_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPXHCSP
MG877715_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALHRDALESPEHCTP
MG877716_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALHRDALESPEHCTP
MG877717_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALHRDALESPEHCTP
MG877707_HBc_P-F      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
MG877706_HBc_P-F      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALFRDALESPEHCSP
MG877722_HBc_P-F      MDIDPYKEFGASRELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
MG877704_HBc_P-F      MDIDPYKEFGASRELLSFLPXDFFPSXRDLLDTASALYRDALESPEHCXP
MG877705_HBc_P-F      MDIDPYKEFGASRELLSFLPXDFFPSXRDLLDTASALYRDALESPEHCXP
MG877721_HBc_P-F      MDIDPYKEFGASRELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
AB116550_HBc_P-F      MDIDPFKEFGASEELLSFLPLDFFPNVRDLLDTASALYRDALESSEHCTP
JQ272888_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB365453_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTATALYRDDLESPEHCTA
FJ589066_HBc_P-F      MDIDPYKEFGASVELLTFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
EU366132_HBc_P-F      MDIDPYKEFGASRELLSFLPNDFYPSARDLLDTATALYRDALESPEHCSP
AB086397_HBc_P-F      MDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREALESPEHCTA
JN688720_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTAXALYRDALESPEHCTP
KJ638664_HBc_P-F      MDIDPYKEFGASEELLSFLPLDFFPSARDLLDTASALYRDALESPEHCTP
MG098575_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPKHCSP
KP995113_HBc_P-F      MDIDPYKEFGASVELLSFLPPDFFPSVRDLIDTASALYRDALESPEHCTP
KJ638663_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSARDLLXTASALYRDALESPEHCTP
AB116654_HBc_P-F      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTA
MG877712_HBc_P-F      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHVTP
MG877714_HBc_P-F      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCTP
KY476328_HBc_P-F      MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYRDALESSEHCTH
KJ586805_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP995097_HBc_P-F      MDIDPYKEFGASVELLSFLPADFFPSARDLFDTASALYRDALESPEHCTP
AF324143_HBc_P-F      MDIDPYKEFGASMELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098580_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
KP995114_HBc_P-F      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALHRDALESPEHCSP
JN792916_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EF576808_HBc_P-F      MDIDPYKEFGASVELLSFLPTDFFPSARDLFDTASALYRDALESPQHCTP
AB365449_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB166850_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB214516_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585194_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM622135_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN792914_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KJ638656_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX899376_HBc_P-F      MDIDPYKEFGASAELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCTP
JN792917_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN688701_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRXALESPEHCTH
EU185743_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899146_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLFDTASALYRDALESPEHCTP
KY476325_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYRDALESPEHCTH
KC494396_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY311370_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090459_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MG098578_HBc_P-F      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTP
AY254498_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB036905_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036906_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036907_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036908_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036909_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036910_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036911_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036912_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036913_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036914_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036915_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036916_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036917_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036919_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB036920_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB064316_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB116549_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB116551_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB116552_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN688691_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JF439885_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JF439884_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HQ420166_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HQ420165_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HQ378247_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM590474_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM590473_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM590472_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM590471_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585200_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585199_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585198_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585197_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585196_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585195_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585193_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585192_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585191_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585190_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585189_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585188_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585187_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM585186_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HE981186_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HE981182_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HE981181_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709494_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709465_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709464_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709463_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709462_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709460_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709459_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709458_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ709457_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ657529_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ657528_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ657522_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ657519_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ589065_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU670262_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU670261_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU366133_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU366118_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU366116_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU185744_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EF576812_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899150_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899149_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899148_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899147_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899145_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899144_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899143_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ899142_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823095_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823094_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823093_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823092_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823091_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823090_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823089_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823088_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823087_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ823086_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
DQ776247_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY311369_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY179735_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090461_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090458_HBc_C-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090455_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AF223965_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AF223964_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AF223963_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AF223962_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN792921_HBc_P-F      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTP
JN792918_HBc_P-F      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTH
AB365450_HBc_P-F      MDIDPYKEFGASVELLSFLPXDXXPSVRDLLDTASALYRDALESPEHXTP
HM627320_HBc_P-F      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
                      **** :**:*** ** :**. *  *  ***: ** .*..  * *. *   

KC494399_HBc_P-F      HHTALRQAVGCWGEVSTLASWVGNNLEDPAARDLVVNYVNTNMGLKLRQL
MG098583_HBc_P-F      HHTALRQAISCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGVKMRQY
MG098574_HBc_P-F      NHTALRQAILCWGELMILASWGGNILENPAAGDLLVNSVNTHVGLKMKQL
MG098577_HBc_P-F      NHTALRQAILCWDELMTFAAWVGNNLEDPAARDLVVNYVNINMGLKIRQL
MG098569_HBc_P-F      HHTAIRQAILCWGELMVFASWVGNNLQDPASRDLVVDYVNINMGLKITQL
KY476330_HBc_P-F      HHTALRHVILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KP995115_HBc_P-F      HHTALRQAILCWDELMIFASWVGNNLDDPASRDLVVNYVNINMGLKIRRL
KP995101_HBc_P-F      HHTAIRQIILCWGELMSLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQM
MG098566_HBc_P-F      HHTALRQAILCWNELMTFASWVGNNLDDPAARDLVVNYVNINMGLKIRQL
JN792919_HBc_P-F      NHTALRQAILCWGELMIFASWVGNNLEDPAARDLVVNYVNINMGLKIRRL
MG098573_HBc_P-F      HHTAIRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ676694_HBc_P-F      HHTALRQAILCWTEVMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KJ638660_HBc_P-F      NHTALRQAIVCWGEVMTLAAWVGHNLEDPAARDLVVNYVNTNMGLKIRQL
MG877708_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KY476329_HBc_P-F      NHTALRQAILCWNEVTEFGNWVGNNLEDPAARDLVVDYVNTNMGLKIRQL
KY476326_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KP995111_HBc_P-F      HHTALRQTVLCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494400_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVKYVNTNMGLKIRQL
FJ589067_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KT896494_HBc_P-F      HHTALRQAILCWVELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718110_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
JN688709_HBc_P-F      HHTALRQAIVCWGEVXTXASWVGHNLEDPAARDLVVNYVNTNMGLKIRQL
MK183637_HBc_P-F      HHTAVRQAILCWGELMTLAAWVGNNLEDPAARDLVVNYVNTHMGLKMRQI
MG877703_HBc_P-F      HHTALRQAILCWDELMIFASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MG098579_HBc_P-F      HHTALRQAVLCWGELMNLASWVGNNLEDPAARDLVVNYVNXHMGLKIRQI
KJ843195_HBc_P-F      NHTALRQAILCWSEVMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ586808_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494394_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995119_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQL
KP995095_HBc_P-F      NHTALRQAIVCWGEVMTLASWVGNHLEDPAARDLVVNYVNTNMGLKIRQL
KJ843167_HBc_P-F      NHTALRQAILGWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB365446_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KJ586807_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ586806_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KF199901_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494405_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494404_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494403_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494402_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494401_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494398_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494397_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC494395_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX079937_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX079936_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN811656_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN811655_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN792922_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN688703_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN688699_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIXQL
MK183644_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183633_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIKQL
MK183638_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIKQL
MK183643_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183630_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183641_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183635_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183636_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183639_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ638662_HBc_P-F      HHTALRQXILCWGELTNLGSWVGNNLEDXAARDXVVNYVNTNMGLKTRQL
KP995109_HBc_P-F      NHTALRQAIVCWGEVMTLASWVGHNLEDPAARDLVVNYVNTNMGLKIRQL
KP995105_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843225_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN792920_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVNXNMGLKIRQL
MH051987_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MG098565_HBc_P-F      SHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQL
KY476327_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX757672_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995106_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQM
KP718107_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KJ843194_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843191_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843169_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843168_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ638659_HBc_P-F      NHTALRQAILCWTEVMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995096_HBc_P-F      NHTAFRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718113_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718104_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MG098570_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQL
KY476331_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995107_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718109_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
X75663_HBc_P-F        NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
X75658_HBc_C-F        NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
X69798_HBc_P-F        NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183647_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK183640_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MK058437_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MH051986_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MG098564_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY476332_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY476324_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KY476323_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY476322_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY458062_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY458061_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY382411_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX757665_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX264499_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX264498_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX264497_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX264496_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995126_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995125_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995124_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995123_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995120_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995118_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995116_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995110_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995104_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995098_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995091_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718112_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718111_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP718103_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KM998715_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KM233681_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843226_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843224_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843223_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843222_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843221_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843220_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843219_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843213_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843212_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843211_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843210_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843209_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843208_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843207_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843206_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843205_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843204_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843203_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843202_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843201_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843200_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843199_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIXQL
KJ843198_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843197_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843196_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843193_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843190_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843189_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843185_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843181_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843180_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843179_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843178_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843177_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843176_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843175_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843174_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843171_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843170_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843164_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ843163_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
OK106257_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLAVNYVNTNMGLKIRQL
KP995117_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KJ638657_HBc_P-F      XHTALRQAILCWGELMTXASWVGNNLEDPXARBLVVBYVNXNMGLKIRXL
KY382417_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVNTNMGLKIRQL
KY382416_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVNTNMGLKIRQL
KP718106_HBc_P-F      NHTALRQAILCWGELMTLASWVGXNLEBPAARDLXXNYVNTNMGLKIRQL
KY382415_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVNTNMGLKIRQL
MK183632_HBc_P-F      HHTALRQAILCWHEVMNLASWVGNNLDDPASRDLVVNYVNTNMGLKIRQL
MK183631_HBc_P-F      HHTAIRQAILCWGELMIFASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ657525_HBc_P-F      HHTALRQVSLCWSELMTFAIWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
MG877700_HBc_P-F      HHTALRQVXLCWXEXMXFANWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
MG877715_HBc_P-F      HHTALRQAIVCWGEVMTFAXWVGQNLQDPAARDLVVNYVNTNMGLKIRQL
MG877716_HBc_P-F      HHTALRQAIVCWGEVMTFAXWVGQNLQDPAARDLVVNYVNTNMGLKIRQL
MG877717_HBc_P-F      HHTALRQAIVCWGEVMTFAXWVGQNLQDPAARDLVVNYVNTNMGLKIRQL
MG877707_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
MG877706_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
MG877722_HBc_P-F      NHTALRQAILCWDELMIFASWVGNNLDDPAARDLVVNYVNTNMGLKIRQL
MG877704_HBc_P-F      XHTALRQAILCWDELMIFASWVGNNLXDPAARDLVVNYVNTNMGLKIRQL
MG877705_HBc_P-F      XHTALRQAILCWDELMIFASWVGNNLXDPAARDLVVNYVNTNMGLKIRQL
MG877721_HBc_P-F      NHTALRQAILCWDELMIFASWVGNNLDDPAARDLVVNYVNTNMGLKIRQL
AB116550_HBc_P-F      HHTALRQAILCWGELMIFAAWVGNNLEDPAARDLVVNYVNTNMGLKIRRL
JQ272888_HBc_P-F      HHTAIRQAILCWGELMVFASWVGNNLQDAAARDLVVDYVNTHMGLKIRHL
AB365453_HBc_P-F      HHTALRQAIVCWGEVMTLASWVGNNLDDPGARDLVVNYVNTHMGLKIRQL
FJ589066_HBc_P-F      HHTALRQAILCWGELMVFASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
EU366132_HBc_P-F      HHTVIRQAVLCWGELMTLASWVGNNLEDPAARDLVVNYVNTTVGLKLRQL
AB086397_HBc_P-F      HHTALRQAILCWGELTTLATWVGNNLDDPAARDLVVNYVNTHMGLKTRQL
JN688720_HBc_P-F      HHTAIRQAVLCWNELMTFASWVGNNLEDPAARDLVVNYVNINMGLKIRQL
KJ638664_HBc_P-F      HHTALRQAILCWNEVTTLASWVGNNLEDPAARDQVVNYVNTNMGLKIRQL
MG098575_HBc_P-F      HHTAIRQAVLCWGELMTLASWVGNNLDDPAARDLVVNYVNTHMGLKIRQL
KP995113_HBc_P-F      NHTAIRQVLLCWNELMTFASWVGENLDDPAARNSVVNYVNTNMGLKIRQL
KJ638663_HBc_P-F      HHTALRQAVLCWTEVMTLATWVGHNLDDPAARDLVVNYVNTNMGLKIRQL
AB116654_HBc_P-F      HHTAIRQIVLCWGELMTLASWVGNNLDDPAARDLVVNYVNTHMGLKIRQL
MG877712_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVNTNMGLKIRQL
MG877714_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPXARDLVVNYVNTXMGLKIRQL
KY476328_HBc_P-F      HHTALRQAILCWGEVMNLASWVGNNLQDPAARDLVVNYVNTHMGLKIRQL
KJ586805_HBc_P-F      NHTAFRQAILCWGELMTLASWGGNNLEDPAARDLVVNYVNTNMGLKIRQL
KP995097_HBc_P-F      HHTALRQAILCWGELTTLASWVGNNLDDAAARDLVVNYVNTHMGLKIRQL
AF324143_HBc_P-F      NHTALRQAILCWGELMIFASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MG098580_HBc_P-F      HHTALRQAIVCWNEVIALASWVGNNLDDPAARDLVVNYVNTNMGLKIRQL
KP995114_HBc_P-F      HHTAIRQAVSCWGELITLASWVGNNLDDPAARDLVVNYVNTHMGLKIRQL
JN792916_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EF576808_HBc_P-F      HHTALRQAILCWGELTTLASWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB365449_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLQDPAARDLVVNYVNTHMGLKIRQL
AB166850_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB214516_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585194_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM622135_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN792914_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
KJ638656_HBc_P-F      HHTAIRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
JX899376_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN792917_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLQDPAARDQVVNYVNTNMGLKIRQL
JN688701_HBc_P-F      XHTALRQAILCWGELMNLASWVGNNLDDPAARDLVVNYVNTNMGLKIRQL
EU185743_HBc_P-F      NHTALRQAILCWGELMTLASLVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899146_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KY476325_HBc_P-F      HHTALRQAIVCWLEVTTLASWVGNNLDDPAARDLVVNYVNTNMGLKIRQL
KC494396_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLDDPGARDLVVNYVNTNMGLKVRQL
AY311370_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090459_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPADRDLVVNYVNTNMGLKIRQL
MG098578_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
AY254498_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036905_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036906_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036907_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036908_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036909_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036910_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036911_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036912_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036913_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036914_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036915_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036916_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036917_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036919_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB036920_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB064316_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB116549_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB116551_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB116552_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN688691_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JF439885_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JF439884_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HQ420166_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HQ420165_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HQ378247_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM590474_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM590473_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM590472_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM590471_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585200_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585199_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585198_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585197_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585196_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585195_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585193_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585192_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585191_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585190_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585189_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585188_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585187_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM585186_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HE981186_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HE981182_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HE981181_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709494_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709465_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709464_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709463_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709462_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709460_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709459_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709458_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ709457_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ657529_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ657528_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ657522_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ657519_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ589065_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU670262_HBc_P-F      NHTALRQAILCWGELVTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU670261_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU366133_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
EU366118_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU366116_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU185744_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EF576812_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899150_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899149_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899148_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899147_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899145_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899144_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899143_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ899142_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823095_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823094_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823093_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823092_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823091_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823090_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823089_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823088_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ823087_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTHMGLKIRQL
DQ823086_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
DQ776247_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY311369_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY179735_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090461_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090458_HBc_C-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090455_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AF223965_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AF223964_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AF223963_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AF223962_HBc_P-F      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JN792921_HBc_P-F      NHTALRQAXLCWGELMTLASWVGNNLEDPXARDLVVNYVNTNMGLKIRQL
JN792918_HBc_P-F      HHTALRQAILCWGELMTLASWVGNNLDDPAARDLVVNYVNTHMGLKIRQL
AB365450_HBc_P-F      HHXALRQAILCWGELMTLASWVGNNLDDPAARDLVVNYVNTHMGLKIRQL
HM627320_HBc_P-F      HHTALRQXILCWGELMTLASWVGNNLDDPAARDLVVNYVNTXMGLKIRQL
                       * ..*:    * *    .   *  *            **  :*:*    

KC494399_HBc_P-F      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
MG098583_HBc_P-F      LWFHVSCLMFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETSVIR
MG098574_HBc_P-F      LWFHISCLIFERKTVLEYLEYFGVWIRTPPAYRPPNAPILSTLPETTVIR
MG098577_HBc_P-F      LWFHISCLTFGRETVXQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MG098569_HBc_P-F      LWFHISCLTFERETVLEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVR
KY476330_HBc_P-F      LWFHTSCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KP995115_HBc_P-F      LWFHISCIMFGRDLVLEYLVSFGVWIRTPPNYRPPNAPILSTLPETTVVR
KP995101_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
MG098566_HBc_P-F      LWFHVSCLTFGREVLLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN792919_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098573_HBc_P-F      LWFHISCLMFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
KJ676694_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVR
KJ638660_HBc_P-F      LWFHISCLTFGREVVLEXLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
MG877708_HBc_P-F      LWFHTSCIIFGREVVVEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
KY476329_HBc_P-F      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEATVVR
KY476326_HBc_P-F      LWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
KP995111_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
KC494400_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ589067_HBc_P-F      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
KT896494_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVR
KP718110_HBc_P-F      LWFHISCIIFGRDIVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
JN688709_HBc_P-F      LWFHISCXXFGRDTVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
MK183637_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MG877703_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098579_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPEXTVVR
KJ843195_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ586808_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494394_HBc_P-F      LWFHISSLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995119_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995095_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843167_HBc_P-F      LWFHISCLTFGRETVLEYLVSLGVWIRTPPAYRPQNAPILSTLPETTVVR
AB365446_HBc_P-F      LWFHISCLXFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ586807_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ586806_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF199901_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494405_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494404_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494403_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494402_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494401_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494398_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494397_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC494395_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX079937_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX079936_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN811656_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN811655_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN792922_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688703_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688699_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183644_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183633_HBc_P-F      LWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183638_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183643_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183630_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183641_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183635_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183636_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183639_HBc_P-F      LWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ638662_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995109_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
KP995105_HBc_P-F      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843225_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
JN792920_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPXXYRPPNAPILSTLPETTVVR
MH051987_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098565_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY476327_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX757672_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995106_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
KP718107_HBc_P-F      LWFHISCLTFGXNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843194_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KJ843191_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843169_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
KJ843168_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ638659_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995096_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718113_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718104_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098570_HBc_P-F      LWFHISCLTFGREXVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTGVR
KY476331_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
KP995107_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718109_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYCPPNAPILSTLPETTVVR
X75663_HBc_P-F        LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
X75658_HBc_C-F        LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
X69798_HBc_P-F        LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183647_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183640_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK058437_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH051986_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098564_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNALILSTLPETTVVR
KY476332_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY476324_HBc_P-F      LWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY476323_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY476322_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY458062_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY458061_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY382411_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX757665_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX264499_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX264498_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX264497_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX264496_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995126_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995125_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995124_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995123_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995120_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995118_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995116_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995110_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995104_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
KP995098_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995091_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718112_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718111_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718103_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KM998715_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KM233681_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843226_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843224_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843223_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843222_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843221_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843220_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843219_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843213_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843212_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843211_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843210_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRRPNAPILSTLPETTVVR
KJ843209_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843208_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843207_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843206_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843205_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843204_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843203_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843202_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
KJ843201_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843200_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843199_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843198_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843197_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843196_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843193_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843190_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843189_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843185_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843181_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843180_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843179_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843178_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843177_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843176_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843175_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843174_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843171_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843170_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843164_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ843163_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
OK106257_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995117_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ638657_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY382417_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY382416_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP718106_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIXTPPAYXPPNAPILSTLPETTVVR
KY382415_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK183632_HBc_P-F      MWFHISCLTFGRETVTQYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MK183631_HBc_P-F      LWFHISCLTFGRQTVLEYLVSFGVWIRTPAPYRPQNAPILSTLPEITVVR
FJ657525_HBc_P-F      LWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MG877700_HBc_P-F      LWFHXSCLTFGXXTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MG877715_HBc_P-F      LWFHISCLSFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSSLPEVTVVR
MG877716_HBc_P-F      LWFHISCLSFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSSLPEVTVVR
MG877717_HBc_P-F      LWFHISCLSFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSSLPEVTVVR
MG877707_HBc_P-F      LWFHTSCIIFGREIVVEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
MG877706_HBc_P-F      LWFHTSCITFGREXVVEYLVSFGVWIRTPPXYRPPNAPILSTLPETTVVR
MG877722_HBc_P-F      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG877704_HBc_P-F      LWFHXSCXXFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG877705_HBc_P-F      LWFHXSCXXFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG877721_HBc_P-F      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB116550_HBc_P-F      LWFHISCLTFGRQVVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIR
JQ272888_HBc_P-F      LWFHLSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIR
AB365453_HBc_P-F      LWFHISCLMFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
FJ589066_HBc_P-F      LWFHISCLTFGRDTVIQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU366132_HBc_P-F      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB086397_HBc_P-F      LWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688720_HBc_P-F      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KJ638664_HBc_P-F      LWFHISCLTFGRTTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETRVIR
MG098575_HBc_P-F      LWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
KP995113_HBc_P-F      LWFHISCLTFGTQTVVEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVR
KJ638663_HBc_P-F      LWFHISCLTFGRETVLNYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
AB116654_HBc_P-F      LWFHISCLTFGRQTVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVR
MG877712_HBc_P-F      CWFHISCLTFGRHTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
MG877714_HBc_P-F      CWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
KY476328_HBc_P-F      LWFHVSCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXR
KJ586805_HBc_P-F      LGFHISSLTFGRETVLEYLVFFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP995097_HBc_P-F      LWFHISCLTFGRETVVQYLVSFGVWIRTPPAYRPPNAPILSMLPEVAVVR
AF324143_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098580_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KP995114_HBc_P-F      LWFHISCLTFGRQVVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVR
JN792916_HBc_P-F      LWFHLSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EF576808_HBc_P-F      LWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AB365449_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB166850_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVR
AB214516_HBc_P-F      LGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585194_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
HM622135_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
JN792914_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ638656_HBc_P-F      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX899376_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN792917_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688701_HBc_P-F      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU185743_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899146_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY476325_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVR
KC494396_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY311370_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090459_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG098578_HBc_P-F      LWFHISCLTFGRPTVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVR
AY254498_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036905_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036906_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036907_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036908_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036909_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036910_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036911_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036912_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036913_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036914_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036915_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036916_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036917_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036919_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB036920_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB064316_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB116549_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB116551_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB116552_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688691_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF439885_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF439884_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ420166_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ420165_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ378247_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM590474_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM590473_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM590472_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM590471_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585200_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585199_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585198_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585197_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585196_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585195_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585193_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585192_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585191_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585190_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585189_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585188_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585187_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM585186_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HE981186_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HE981182_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HE981181_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709494_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709465_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709464_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709463_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709462_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709460_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709459_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709458_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ709457_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ657529_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ657528_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ657522_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ657519_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ589065_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU670262_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU670261_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU366133_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU366118_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU366116_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU185744_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EF576812_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899150_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899149_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899148_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899147_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899145_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899144_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899143_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ899142_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823095_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823094_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823093_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823092_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823091_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823090_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823089_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823088_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823087_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ823086_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ776247_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY311369_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY179735_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090461_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090458_HBc_C-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090455_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF223965_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF223964_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF223963_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF223962_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN792921_HBc_P-F      LWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIIR
JN792918_HBc_P-F      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB365450_HBc_P-F      LWFHISCLTFGRETVLEYLVSXGVWIRTPPXYRPPNAPILSTLPETTVXR
HM627320_HBc_P-F      LWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVR
                        ** *.  *    : : *   ***: **  *   ** *** ***    *

KC494399_HBc_P-F      RRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG098583_HBc_P-F      RRGRSPRRRTPSPRKRRSQSPRRRRSQSPASRC
MG098574_HBc_P-F      RRGRSPRRRTPSPRKRRSQSPRRKRSQSPASQC
MG098577_HBc_P-F      RRGRSPRRRTPSPRKRRSQSPRRKKSQSPASQC
MG098569_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSRC
KY476330_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPGSRC
KP995115_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSRC
KP995101_HBc_P-F      GRGRAPRRRTPSPRRRRSQSPRGRRSQSPSSRC
MG098566_HBc_P-F      RRGRSPRRRTPSPRTRRSQSPRRRRSQSPASRC
JN792919_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG098573_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ676694_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
KJ638660_HBc_P-F      RRGRSPRSRTPSPRRRRSQSPRRRRSQSPASQC
MG877708_HBc_P-F      RRGRSPRXXTPSPRRRRSQSPRRRRSQSPASQC
KY476329_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
KY476326_HBc_P-F      GRGXSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995111_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
KC494400_HBc_P-F      RRGRSPRRRTPSPRRRSSQSPRRRRSQSPASQC
FJ589067_HBc_P-F      RRGRSPGRRTPSPRRRRSQSPRRRRSQSPASRC
KT896494_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSKSPSSQC
KP718110_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN688709_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSQC
MK183637_HBc_P-F      QRGRSLXXXXXXXRRRRSQSPRRRRSQSPASKC
MG877703_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASHC
MG098579_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASHC
KJ843195_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ586808_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494394_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995119_HBc_P-F      RRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995095_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843167_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB365446_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASHC
KJ586807_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ586806_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KF199901_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494405_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494404_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASQC
KC494403_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494402_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494401_HBc_P-F      RPGRSPRKRTPSPRRRRSQSPRRRRSQSPASQC
KC494398_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494397_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494395_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX079937_HBc_P-F      RRGRSXRRRTPSPRRRRSQSPRRRRSQSPASQC
JX079936_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPPSHC
JN811656_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN811655_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN792922_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN688703_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN688699_HBc_P-F      RRGRSPXRRTPSPRRRRSQSPRRRRSQSPASQC
MK183644_HBc_P-F      RRGRSPRTKTPXXRRRRSQSPRRRRSQSPASQC
MK183633_HBc_P-F      RRGRXXXXXXXXXRRRRSQSPRRRRSQSPASQC
MK183638_HBc_P-F      RQGRXXXXXXXXPRRRRSQSPRRRRSQSPASQC
MK183643_HBc_P-F      PQGRSPXXXXXXXRRRRSQSPRRRRSQSPASQC
MK183630_HBc_P-F      RRGRXXXXXXXSPRRRRSQSPRRRRSQSPASQC
MK183641_HBc_P-F      RRGRXXXXXXXSPRRRRSQSPRRRRSQSPASQC
MK183635_HBc_P-F      RRGRXXXXXXXXXRRRRSQSPRRRRSQSPASQC
MK183636_HBc_P-F      RRGRXXXXXXXXXRRRRSQSPRRRRSQSPASQC
MK183639_HBc_P-F      RRGRXXXXXXXXXRRRRSQSPRRRRSQSPASQC
KJ638662_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995109_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995105_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843225_HBc_P-F      QRRRSPRRRTPSPRRRRSQSPRRRRSQSPSSQC
JN792920_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MH051987_HBc_P-F      RRGRSPRRRTPSPGGRRSQSPRRRRSQSPASQC
MG098565_HBc_P-F      RRGRSPRRRTPSPRKRRSQSPRRRRSQSPASQC
KY476327_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX757672_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKGSQSPASQC
KP995106_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718107_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843194_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843191_HBc_P-F      RRGRSPRRRTPSPRXRRSQSPRRRXSQSPASQC
KJ843169_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843168_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ638659_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995096_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718113_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPAPQC
KP718104_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPAPQC
MG098570_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASHC
KY476331_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995107_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718109_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
X75663_HBc_P-F        RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
X75658_HBc_C-F        RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
X69798_HBc_P-F        RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MK183647_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MK183640_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MK058437_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MH051986_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG098564_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASQC
KY476332_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY476324_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
KY476323_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY476322_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY458062_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY458061_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY382411_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX757665_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX264499_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX264498_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX264497_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX264496_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995126_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995125_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995124_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995123_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995120_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995118_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995116_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995110_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995104_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995098_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995091_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718112_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718111_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718103_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KM998715_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KM233681_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843226_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843224_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843223_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843222_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843221_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843220_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843219_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843213_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843212_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843211_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843210_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843209_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843208_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843207_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843206_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843205_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843204_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843203_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843202_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843201_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843200_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843199_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843198_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843197_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843196_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843193_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843190_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843189_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843185_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843181_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843180_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843179_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843178_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843177_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843176_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843175_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843174_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843171_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843170_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843164_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ843163_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
OK106257_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995117_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ638657_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY382417_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY382416_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP718106_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASXC
KY382415_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MK183632_HBc_P-F      RRGRXXXXXXXSPRRRRSQSPRRRRSQSPASQC
MK183631_HBc_P-F      RRGRXXXXXXXXXRRRRSQSPRRRRSQSPASQC
FJ657525_HBc_P-F      GRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
MG877700_HBc_P-F      GRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
MG877715_HBc_P-F      RRGRSPRRRTPSPRRRRSQSQGRRRSQSPASRC
MG877716_HBc_P-F      RRGRSPRRRTPSPRRRRSQSQGRRRSQSPASRC
MG877717_HBc_P-F      RRGRSPRRRTPSPRRRRSQSQGRRRSQSPASRC
MG877707_HBc_P-F      RRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG877706_HBc_P-F      RRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG877722_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSQC
MG877704_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASHC
MG877705_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASHC
MG877721_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSQC
AB116550_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JQ272888_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSRC
AB365453_HBc_P-F      PRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ589066_HBc_P-F      PRGRTPRRRTPSPRRRRSQSPGRRRSQSPSSQC
EU366132_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB086397_HBc_P-F      RRGRSPRRRTPSPRRRRSKSPRRRRSQSPSSQC
JN688720_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ638664_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG098575_HBc_P-F      HRGRSTRRRTPSPRKRRSQSPRLKRSQSPASQC
KP995113_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ638663_HBc_P-F      RRVRSPRRRTPSPRRRRSQSPRRRRSQSPDSRC
AB116654_HBc_P-F      GRRRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
MG877712_HBc_P-F      QRRRSPRXXTPSPRRRRSQSPRRRRSQSPASQC
MG877714_HBc_P-F      QRRRSPRXXTPSPRRRRSQSPRRRRSQSPASQC
KY476328_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ586805_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995097_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AF324143_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
MG098580_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KP995114_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN792916_HBc_P-F      RRGRSPRRRTPTPRRRRSQSPRRRRSQSPASQC
EF576808_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB365449_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB166850_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB214516_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585194_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM622135_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN792914_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KJ638656_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX899376_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN792917_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN688701_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU185743_HBc_P-F      RXGRSPRRRTPSPRRQRSQSPRRRRSQSPASQC
DQ899146_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KY476325_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC494396_HBc_P-F      RRGRTPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY311370_HBc_P-F      RRGRSPRRRTPSRRRRRSQSPRRRRSQSPASQC
AY090459_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASPC
MG098578_HBc_P-F      GRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY254498_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036905_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036906_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036907_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036908_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
AB036909_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036910_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036911_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036912_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036913_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036914_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036915_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036916_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036917_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036919_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB036920_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB064316_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB116549_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB116551_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB116552_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN688691_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JF439885_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JF439884_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HQ420166_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HQ420165_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HQ378247_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM590474_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM590473_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM590472_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM590471_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585200_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585199_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585198_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585197_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585196_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585195_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585193_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585192_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585191_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585190_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585189_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585188_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585187_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM585186_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HE981186_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HE981182_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HE981181_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709494_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709465_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709464_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709463_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709462_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709460_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709459_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709458_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ709457_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ657529_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ657528_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ657522_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ657519_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASQC
FJ589065_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRKRSQSPASQC
EU670262_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU670261_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU366133_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU366118_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU366116_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU185744_HBc_P-F      RRGRSPRRRTPSPRRXRSQSPRRRRSQSPASQC
EF576812_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899150_HBc_P-F      RRGRSPRRRTPSPRRRRSQLPRRRRSQSPASQC
DQ899149_HBc_P-F      RRGRSPRRRTPSPRRRRSQWPRRRRSQSPASQC
DQ899148_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899147_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899145_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899144_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899143_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ899142_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823095_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823094_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823093_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823092_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823091_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823090_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823089_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823088_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ823087_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
DQ823086_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
DQ776247_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY311369_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY179735_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090461_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090458_HBc_C-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090455_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPGSQC
AF223965_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AF223964_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AF223963_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AF223962_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
JN792921_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
JN792918_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB365450_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM627320_HBc_P-F      RRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
                                       *:    . *:** . *

© 1998-2022Legal notice