HBVdb

Dataset for protein Pol of genotype D

[Download (right click)] [Sequences] [Repertoires]

1685 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


JN257177_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGNNIN
KF779220_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MW601281_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
EF103281_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594404_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GU456665_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310707_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097737_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JF754588_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ922004_Pol_P-D      MPLSYPHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598675_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594401_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KT749823_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594398_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
GQ477455_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ477456_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADQDLNRRVAEDLNLGN-LN
MN310706_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JQ707526_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX096957_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
HQ700472_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PT
EU414135_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040788_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787438_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601318_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097775_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ647352_Pol_P-D      MPLSYQXFRRLLLLDDE--SGPLEEELPRLADEDLNRRVADDLNLGN-LS
GU456658_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456676_Pol_P-D      MPLSYHHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN792911_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEQELPRLADEGLNRRVAEDLNLGN-LN
AB222710_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX357637_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN664926_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ167302_Pol_P-D      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
OM304322_Pol_P-D      MPLSYQCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN688685_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594400_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KM524353_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603396_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603383_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724247_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLANEDLNRRVAEDLNLGN-LN
JN664948_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN792903_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603392_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ336680_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGK-LN
LT992444_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674415_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
KJ470885_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ627218_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
AF043594_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594426_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097840_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779230_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
JN257173_Pol_P-D      MPLSYRHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257195_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM577670_Pol_P-D      MPLSYQYFRRLVLLDND--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KX827300_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK355501_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
JN040820_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674424_Pol_P-D      MPLSYQLFRRLLLLDPE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584165_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
L27106_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
OK143487_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
AB119255_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ399006_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN844882_Pol_P-D      MPLSYPYFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
AB188242_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN792905_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674428_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PD
KM524348_Pol_P-D      MPLSYQLFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB126581_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097883_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
LC365689_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598673_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598672_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097857_Pol_P-D      MPLSCQRFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT579903_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598671_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN040769_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052952_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB090269_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MG877728_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEXXLPRLABEGLNRRVAEDLNLGN-LN
MW601331_Pol_P-D      MPLSYQHFRRLVLLDNE--AGSLEEELPRLADEDLNRRVAEDLTLGN-LN
KX276857_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-XN
MW999632_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT114169_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601311_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ336691_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MT603384_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB188241_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KM524355_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594424_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594425_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT603397_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270542_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT579901_Pol_P-D      MPLSYQYFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594408_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KF679997_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594399_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ183448_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGI-LN
MZ097781_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
HQ700480_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB330369_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724246_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEELNLGN-LN
GU456678_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX096956_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601339_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601254_Pol_P-D      MPLSYQHFRRLLLXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXX-LN
JX096954_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM025254_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097661_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ627220_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097723_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MT603394_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925366_Pol_P-D      MPLSYLHFRRLVLLDND--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601338_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674431_Pol_P-D      MPLSYHHFRRLVLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM333239_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNPRVADDLDLGD-LN
EU594428_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH464839_Pol_P-D      --------RRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594402_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KM524347_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904429_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
ON585703_Pol_P-D      MPLSYQHFRRLLLLDKD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601268_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-VN
GU456662_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB048701_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AB090268_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB090270_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB104709_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB104710_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB104711_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB104712_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB109475_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB109476_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB109477_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB109478_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB109479_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
AB110075_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB116266_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB119251_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB119252_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
AB119253_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
AB119254_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB119256_Pol_P-D      MPLSYHHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
AB120308_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
AB188244_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB205126_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB205127_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB205128_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AB210820_Pol_P-D      MPLSYQHFRRLLLLEDE--SGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AB210821_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAKDLNLGN-LN
AB222709_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB222711_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
AB222712_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB222713_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB246347_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB246348_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB267090_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270539_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270541_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AB270543_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270546_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270547_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270548_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB270550_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PT
AB330367_Pol_P-D      MPLSYQCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB330370_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AB493846_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEDELPRLADEGLNRRVAEDLNLGN-LN
AB555496_Pol_P-D      MPLSYQHFWRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LY
AB555497_Pol_P-D      MPLSYQHFWRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB555500_Pol_P-D      MPLSYQHFRRLLLLDXE--AGPLEEELPRLADEDLNRRVAEDLNLGT-PN
AB555501_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
AB583680_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674405_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AB674406_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674407_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674408_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674411_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
AB674416_Pol_P-D      MPLSYQHFRRVLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
AB674419_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
AB674420_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB674422_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGXNRRVAEDLNLGN-LN
AB674423_Pol_P-D      MPLSYQHFRSVLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGT-LN
AB674425_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEDELPRLADEGXNRRVAEDLNLGN-LN
AB674427_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
AF121239_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AF121240_Pol_C-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AF121241_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AF121242_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AF151735_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AF280817_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ131956_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ344116_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ627215_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
AJ627216_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
AJ627219_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AJ627222_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADXDLNHRVAEDLNLGN-LN
AJ627223_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AJ627224_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AM422939_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY090452_Pol_P-D      MPLSYQHFRSVLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGK-LN
AY090453_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY161150_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AY161151_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AY161157_Pol_P-D      MPLSYQHFRRPLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY161158_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
AY233291_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY233292_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY233294_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY233296_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AY236160_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
AY236162_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
AY236164_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELSHLADEGLNRRVAEDLNLGN-LN
AY661792_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY661793_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY721605_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY721606_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY721607_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY721609_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY721611_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY741794_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAQDLNLGD-LN
AY741795_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAQNLNLGD-LN
AY741796_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAQNLNLGD-LN
AY741797_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAENLNLGN-LN
AY741798_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAENLNLGN-LN
AY796030_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY796031_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY796032_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY945307_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLANEGLNRRVAEDLNLGN-LN
DQ111986_Pol_P-D      MPLSYQHFRRLVLLDXD--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
DQ304547_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
DQ304548_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELSRLADEGLNRRVAEDLNLGD-LN
DQ304549_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELSRLADEGLNRRVAEDLNLGD-LN
DQ304550_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
DQ304551_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
DQ315776_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ329356_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRGGEDLNLGN-LN
DQ329357_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRGGEDLNLGN-LN
DQ336674_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336676_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336677_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336678_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336679_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336681_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGK-LN
DQ336682_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGK-LN
DQ336683_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ336684_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGK-LN
DQ336685_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LL
DQ336686_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336687_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336688_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336689_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELSHLADEGLNRRVAEDLNLGN-LN
DQ336690_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ336692_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ464168_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464169_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464170_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464172_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLQEELPHLADEGLNRRVAEDLNLRN-LT
DQ464173_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464174_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ464175_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464176_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ464177_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ464178_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ464181_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ464182_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNLRVAEDLNLGN-LN
DQ486021_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
DQ486025_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
EF103275_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EF103276_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EF103277_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EF103279_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLANEGLNRRVAEDLNLGN-LN
EF103280_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU155893_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU414136_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU414138_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU414139_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEEXPRLADEDLNRRVAEDLNLGN-LN
EU414140_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU414141_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLXDEGLNRRVAEDLNLGN-LN
EU414142_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU414143_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRXAEDLNLGN-LN
EU594382_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594396_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594397_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU594403_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594407_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594409_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594414_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594415_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594416_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594417_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594418_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594419_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594421_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594422_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594429_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594430_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594432_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594433_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594434_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787436_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787437_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787440_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787441_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787442_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787443_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
EU787445_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787446_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU787447_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU919197_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
EU921418_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEDELPRLADEGLNRRVAEDLNLGN-LN
EU921419_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEDELPRLADEGLNRRVAEDLNLGN-PN
EU939680_Pol_P-D      MPLSYQHFRRLLLLDNE--AGTLEEELPRLADEGLNRRVAEDLNLGN-LN
EU939681_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349205_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
FJ349206_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLHLGN-LN
FJ349208_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
FJ349209_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349213_Pol_P-D      MPLSYQHFRRLVLLDND--TGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349214_Pol_P-D      MPLSYQRFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349215_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349216_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349218_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349219_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
FJ349220_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
FJ349228_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349229_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349230_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349231_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349232_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349233_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349234_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ349235_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
FJ386590_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ562309_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ562338_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ692506_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ692532_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPXLADEDLNRRVAEDLNLGN-LN
FJ692533_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
FJ899792_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904395_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904399_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLAXEGXNRRVAEDLNLGN-LN
FJ904402_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGVNRRVAEDLNLGN-XN
FJ904410_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904412_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904415_Pol_P-D      MPLSYQHFRSILLLDDE--AGPLEEELPRVAVEGVNRRVAEDLNLGN-LN
FJ904418_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904419_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904420_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904422_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904424_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
FJ904426_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904427_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904431_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904432_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
FJ904433_Pol_C-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVADDLNLGN-XN
FJ904435_Pol_P-D      MPLSYQHFRRLLLLEEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904438_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
FJ904439_Pol_P-D      MPLSYQHFRRLLLLDQE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904443_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904445_Pol_P-D      MPLSYQHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904446_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ167301_Pol_P-D      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ183449_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183452_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183455_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183457_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183458_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183459_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183460_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183461_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183463_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183465_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183467_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183468_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183470_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
GQ183471_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183472_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183473_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ183474_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183475_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEKLPRLADEGLNRRVAEDLNLGN-LN
GQ183476_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183478_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ183479_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183481_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183482_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183483_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183484_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ184322_Pol_P-D      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEGLDRRVAEDLNLGT-LN
GQ205380_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ205382_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ205384_Pol_P-D      MPLSYQHFRRLLLLDGE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ205385_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ205388_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ205389_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
GQ377589_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ477452_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ477453_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEDLNRRVAEDLNLGT-PN
GQ477457_Pol_P-D      MPLSYQHFRKLLLLDDD--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ477458_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ477459_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ922000_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-PN
GQ922001_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ922002_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ922003_Pol_P-D      MPLSYPHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GQ922005_Pol_P-D      MPLSYPHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGT-LN
GQ924652_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU357846_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456635_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GU456636_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456637_Pol_P-D      MPLSCQHFRRLVLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456638_Pol_P-D      MPLSYQHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456639_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPIEEELPRLADEGLNRRVAEDLNLGN-LN
GU456640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456641_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
GU456643_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456645_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
GU456646_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456647_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDVNLGN-LN
GU456648_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456649_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456650_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456651_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LH
GU456652_Pol_P-D      MPLSYQCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456653_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456654_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGT-PN
GU456655_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456656_Pol_P-D      MPLSYQHFRRLLLLDDE--SGPLEEELPRLADEDLNRRVAEDLNLGN-LN
GU456657_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
GU456659_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456660_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456661_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456663_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456664_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456666_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456667_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456668_Pol_P-D      MPLSYRHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456669_Pol_P-D      MPLSYQHFRRLLLLDPD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456670_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
GU456671_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
GU456673_Pol_P-D      MPLSYQHFRRLLLLEDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456674_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEDELPRLADEDLNRRIAEDLNLGD-LN
GU456675_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456677_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456679_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456680_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456681_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456682_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456683_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GU456684_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HM750151_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HM750152_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEKELPRLADEGLNRRVAEDLNLGN-LN
HM750153_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HM750154_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HM750155_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HM750156_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ236014_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
HQ236015_Pol_P-D      MPLSYQHFRRLVLLDDD--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
HQ236016_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
HQ700440_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700441_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700442_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700444_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700445_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700447_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700448_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700449_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700454_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700455_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLAXEGXNXRVAKDXNXGN-LN
HQ700458_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
HQ700463_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
HQ700464_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700466_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700469_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700471_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700473_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700474_Pol_P-D      MPLSYHHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700477_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700478_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700481_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700483_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700484_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700487_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700510_Pol_P-D      MPLSYQHFRRLLLLDND--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700511_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700512_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700513_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700514_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700553_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ833465_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ833467_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ833468_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
HQ833469_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ833470_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ833471_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439692_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439693_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439694_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PT
JF439695_Pol_P-D      MPLSYQHFRKLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439696_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
JF439699_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439700_Pol_P-D      MPLPYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439702_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439703_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439704_Pol_P-D      MPLPYQHFRKLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF439706_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF439707_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439708_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439709_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439710_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF439712_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439713_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEGLPRLADEGLNRRVAEDLNLGN-LN
JF439716_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEEPPRLADEGLNRRVAEDLNLGN-LN
JF439717_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439718_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439719_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF754590_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754591_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JF754592_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754593_Pol_P-D      MPLSYQHFRRLLFLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754594_Pol_P-D      MPLSYQHFRRLLLLDDE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754595_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
JF754596_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754597_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JF754598_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754599_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754600_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754601_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754602_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
JF754603_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754604_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JF754606_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754607_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JF754609_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754610_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754611_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754612_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEDLNRRVADDLNLGT-LN
JF754614_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754615_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754617_Pol_P-D      MPLSYQCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JF754618_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAKDLNLGN-LN
JF754619_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
JF754621_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JF754622_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754623_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754624_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754626_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
JF754627_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754628_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754629_Pol_P-D      MPLSYQRFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JF754630_Pol_P-D      MPLSCQHFRRLLLLDNE--SGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF754631_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
JF754632_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754633_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754634_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF754635_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
JN040750_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN040751_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040753_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JN040755_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
JN040756_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040757_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040758_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040759_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040761_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040762_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040765_Pol_P-D      MPLSYQYFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040766_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRLVAEDLNLGK-LN
JN040767_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGH-LN
JN040768_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040770_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040771_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040773_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLHLGD-LN
JN040774_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN040775_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040777_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
JN040778_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADAGLNRRVAEDLNLGN-LN
JN040779_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040781_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040782_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PD
JN040783_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040784_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040785_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040786_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040787_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040790_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040791_Pol_P-D      MPLSYQHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040792_Pol_P-D      MPLSYQHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040793_Pol_P-D      MPLSYQHFRRLLLLDNE--AGSLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040794_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040795_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLHLGD-LN
JN040796_Pol_P-D      MPLSYQRFRSVLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN040797_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040799_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040800_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LD
JN040801_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LD
JN040802_Pol_P-D      MPLSYQHFRRLLLLEDD--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN040805_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040806_Pol_P-D      MPLSYQHFRRLLLLDDE--TGSLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040807_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040808_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRIAEDLNLGN-LN
JN040809_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040810_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040811_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
JN040812_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040813_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN040814_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN040815_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040818_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040819_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040821_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
JN040822_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JN040823_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040824_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAENLNLGN-LN
JN040826_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040827_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040828_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040829_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN040830_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257148_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257149_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257150_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257151_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257152_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257153_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257155_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257159_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-XN
JN257160_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRXVAXDLNLGN-LN
JN257162_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257163_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257165_Pol_P-D      MPLSYQHFRRLLFLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
JN257166_Pol_P-D      MPLSYQHFRRLLFLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
JN257169_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257170_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257171_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257172_Pol_P-D      MPLSYRHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257176_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-VN
JN257179_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257181_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257182_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257183_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257185_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257186_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257187_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257188_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257190_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNLRVAEDLNLGN-LN
JN257193_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257196_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257199_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257200_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN257201_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN257202_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257203_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257205_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN257209_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642126_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642128_Pol_P-D      MPLSYQHFPRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642129_Pol_P-D      MPLSYQHFRRLLLLDKD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642130_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642131_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642132_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
JN642133_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN642134_Pol_P-D      MPLSYQHFRRLLLLDAE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642135_Pol_P-D      MPLSYQHFRRLLLLDNN--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
JN642136_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642138_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642140_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642142_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642143_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642144_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642145_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGRHRRVAEDLNLGN-LN
JN642146_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642147_Pol_P-D      MPLSYQHFPRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642148_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
JN642149_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642150_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642151_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642153_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642154_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
JN642155_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642156_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
JN642157_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLHLGD-LN
JN642158_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642159_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
JN642161_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642163_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642165_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN642166_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
JN642167_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRHVAEELNLGN-LN
JN664909_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664910_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664912_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664913_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664914_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664917_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664918_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664919_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664920_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664921_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664922_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664927_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664930_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664931_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664932_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664936_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664937_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664938_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664939_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN664941_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN688678_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN688679_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN688683_Pol_P-D      MPLSYQHFRRLVLLNNK--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN688695_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPIEEELPRLADEGLNRRVAEDLNLGN-LN
JN688708_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JN688710_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADQGLNHRVAEDLNLGD-LN
JN688711_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPVEEELPRLADEGLNRRVAEELNLGN-LN
JN688712_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLTLGT-LN
JN688713_Pol_P-D      MPLSYQHFRRLLLLDEK--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JN792906_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN792907_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADQGLNRRVAEDLNLGN-LN
JN792908_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADQGLNRRVAEDLNLGN-LN
JN792912_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEQELPRLADEGLNRRVAEDLNLGN-LN
JQ687530_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLKEELPRLANEDLNRRVAKDLNLGN-LN
JQ687531_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
JQ707476_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707478_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707479_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707480_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707481_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707483_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707485_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707486_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707487_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707488_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707489_Pol_P-D      MPLSYRHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707490_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707491_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPVEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707493_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707494_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707497_Pol_P-D      MPLSYQQFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707499_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707505_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707507_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707512_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707513_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707515_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707516_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707519_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707523_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707524_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707525_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707529_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707530_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707682_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707683_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707684_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707686_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707687_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707689_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707691_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707693_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707694_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707698_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707699_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707701_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707702_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707703_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707705_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ927384_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
JX096955_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JX470760_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX898689_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX898691_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX898694_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX898697_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875275_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875276_Pol_P-D      MPLSYQHFRSLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875277_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875278_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875279_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875280_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875281_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875282_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875283_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875284_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875285_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875286_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875287_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875288_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875289_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875290_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875291_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875292_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875293_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875294_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875295_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875296_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875297_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875299_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875300_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875301_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875302_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875303_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875304_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875305_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875306_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875309_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875310_Pol_P-D      MRLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875311_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875312_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875313_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875316_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875317_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875319_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875320_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875321_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875322_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875324_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPPEEELPRLADEGLNRRVAEDLNLGN-LN
KC875325_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875328_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875329_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875330_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875331_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875332_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875333_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875334_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875335_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875336_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875337_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875340_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KC875342_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KF053178_Pol_P-D      MPLSYQRFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF061167_Pol_P-D      MPLSYXHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF061168_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF061169_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF061170_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF192830_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF192831_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF192834_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
KF471641_Pol_P-D      MPLSYQHFRRLLCLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471642_Pol_P-D      MPLSYQHFRRLLLLDND--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471644_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471645_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
KF471646_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471647_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471649_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471650_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471651_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471654_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
KF471655_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471656_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471657_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471658_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471659_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471660_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584160_Pol_P-D      MPLSYXRFRXLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-XN
KF584161_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584163_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584166_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679989_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679990_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
KF679992_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
KF679994_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679995_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679996_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679998_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779209_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779212_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779214_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779216_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779217_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
KF779218_Pol_P-D      MPLSNQHFRKLLLLEDE--AGPLEEELPPLADEGLNRRVAEDLTLGN-LN
KF779219_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779222_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779223_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
KF779224_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADQGLYRRVAEDLNLGN-LN
KF779225_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
KF779228_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
KF779288_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779289_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLYRRVAEDLNLGN-LN
KF779292_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779301_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779302_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779318_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779340_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779341_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779376_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779377_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779382_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF922432_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KJ470889_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ470893_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ470894_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ470895_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
KJ470896_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ647350_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KJ647353_Pol_P-D      MPLSYQLFRKLLLLDDE--AGPLKEELPRLADEGLNRRVAEDLNLGD-LN
KJ647355_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
KJ843187_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM519455_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524338_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524339_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LD
KM524340_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KM524342_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524344_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524345_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADDGLNRRVAEDLNLGN-LN
KM524346_Pol_P-D      MPLSYQHFRRLLLLDDK--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524349_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524350_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524351_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524352_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524354_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524356_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM524358_Pol_P-D      MPLSYQHFRRLLLLDDE--SGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KM524361_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGPNRRVAEDLNLGN-LN
KM577668_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
KM577669_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
KM577671_Pol_P-D      MPQSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM606744_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KM606745_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM606752_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAENLNLGN-LN
KM606753_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KM606754_Pol_P-D      MPLSYQHFRSVLLLDDE--AGPLQEELPRLADEDLNRRVAEYLNLGN-HN
KM606755_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNVGN-LK
KP090177_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KP090178_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEKELPRLANEGLNRRVAEDLNLGN-LN
KP090179_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPQEEELPRLADEGLNRRVAEDLNLGN-LN
KP090180_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KP090181_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLRN-LN
KP168419_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
KP322599_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KP322600_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KP322601_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KP995100_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KR905423_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KR905424_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT151620_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT347090_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366465_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366491_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366493_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366494_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366496_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366498_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366499_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366501_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366502_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366508_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366510_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366511_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT749821_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEELHLGN-LN
KT749827_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KT749828_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLANEDLNRRVAEDLNLGN-LN
KT963508_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668433_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KU668435_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KU668439_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668441_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668442_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLAEEGLNRRVAEDLNLGN-LN
KU668444_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668445_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668447_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668448_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668449_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU736924_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KU736925_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KU736926_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU736927_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196208_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196209_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196210_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196211_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196212_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196213_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196214_Pol_P-D      MPLSYQHFRSLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196215_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196219_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196220_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196226_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196227_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196228_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196229_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KX196230_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196231_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196233_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196235_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX276856_Pol_P-D      MPLSYQHFRSVLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KX357622_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
KX357638_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KX357639_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
KX827290_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
KX827291_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX827292_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX827301_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
KY382412_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KY382414_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KY629630_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KY629633_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KY629634_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVADELNLGN-LN
LT992454_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
M32138_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRHVAEELNLGN-LN
MF488704_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618340_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618343_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618348_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618349_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925358_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925363_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925364_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925379_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925383_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925391_Pol_P-D      MPLSYQHFRSVLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF925393_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MG877709_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MG877718_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MG877719_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPXXXXLPRLADEGLNRRVAEDLNLGD-LN
MG877720_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MG877726_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEXXLPRLABEGLNRRVAEDLNLGN-LN
MH464841_Pol_P-D      --------RRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724214_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724215_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724216_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLAXEDLNRRVAEXLNLGN-LN
MH724217_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724220_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724223_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724224_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724225_Pol_P-D      MPLSYQHFRRLLWLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724226_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724227_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724228_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724231_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724232_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724233_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724234_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724235_Pol_P-D      MPLSYQHFRRLLCLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
MH724236_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724237_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724238_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724241_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724242_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MH724244_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MH724245_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPHLADEGLNRRVAEDLHLGN-LN
MH724248_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDFNLRN-LN
MH724249_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724250_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAKDLNLGN-LN
MH724251_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724252_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH932714_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052947_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDHNLGN-LN
MK052948_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052949_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDFNLGN-LN
MK052950_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052951_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052953_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052954_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052955_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052956_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052958_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052959_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052960_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052961_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052963_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052966_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052971_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRPADEGLNRRVAEDLNLGN-LN
MK052972_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052973_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052974_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADDGLNRRVAEDLNLGN-LN
MK355500_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK507910_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK507912_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MK507914_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK516278_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK541688_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598636_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598637_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
MK598638_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598639_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598641_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MK598642_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598643_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598644_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598645_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598646_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598647_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598648_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
MK598649_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598650_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598651_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598655_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598657_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MK598658_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598659_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598660_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598661_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598662_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598663_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598664_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598665_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598666_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598667_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598668_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598669_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598670_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK598674_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
MK598676_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598677_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598678_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK598679_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK618418_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK618419_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK618420_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK618422_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MK618423_Pol_P-D      MPLSYQQFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618424_Pol_P-D      MPLSYQQFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618425_Pol_P-D      MPLSYQQFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618426_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MK618427_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618428_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618429_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618430_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618431_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618432_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618433_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618434_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618435_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618436_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618437_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618441_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618443_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK693107_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK693108_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK693109_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310705_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310708_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310709_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310710_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310711_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310712_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310713_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN310714_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPXLADEGLNRRVAEDLNLGN-LN
MN310715_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN507836_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN507837_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEEIPRLADEGLNRRVAEDLNLGN-LN
MN507838_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN507839_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPCLADEGLNRRVAEDLNLGN-LN
MN507851_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN507852_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEELNLGN-LN
MN507853_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN839643_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MN844881_Pol_P-D      MPLSYQCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MT114172_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MT114173_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT579898_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT579899_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT579900_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT579902_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT591276_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT591277_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT591278_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT591279_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MT591281_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603387_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603388_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603389_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603390_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603391_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603393_Pol_P-D      MPLSYQYFRRLLLLDDE--AGPLEEELPRLANEGLNRRVAEDLNLGD-LN
MT603395_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603398_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603399_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603400_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603402_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603403_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603404_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEQELPRLADEGLNRRVAEDLNLGN-LN
MW082640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW455166_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601228_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601229_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601231_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADQGLNRRVAEDLNLGD-LN
MW601232_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601233_Pol_P-D      MPLSYQHFRRLVLLDED--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601234_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601236_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601237_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADPDLNRRVAEDLGLGN-LN
MW601238_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADQDLNRRVAEDLNLGN-LN
MW601239_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MW601242_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MW601243_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601244_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601245_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MW601246_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MW601247_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601248_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601249_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601250_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MW601251_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601252_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601253_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601255_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601256_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601257_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601258_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MW601259_Pol_P-D      MPLSYQHFRKLLLLDVE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MW601261_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601262_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601263_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601265_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MW601266_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601267_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601269_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601271_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601272_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601273_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601274_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601275_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601276_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601278_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601279_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601280_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601282_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601283_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601285_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601286_Pol_P-D      MPLSYRHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MW601287_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-PN
MW601288_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MW601289_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601290_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601291_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MW601292_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601293_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601294_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601295_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601297_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LH
MW601298_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601299_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601300_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601301_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601302_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601303_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601305_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601306_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LH
MW601307_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601308_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601309_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601312_Pol_P-D      MPLSYQHFRRLLLLDDE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LH
MW601313_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601314_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601315_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601316_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MW601319_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601320_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601321_Pol_P-D      MPLSYQHFRNVLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601323_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601324_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601325_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601326_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601327_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601328_Pol_P-D      MPLSYQRFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601329_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601330_Pol_P-D      MPLSYQHFRRLLLLDDE--TGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601332_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
MW601333_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW601334_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601335_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601336_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW601337_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW675897_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW675898_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW847931_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LB
MW999631_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999634_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999635_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999636_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAKDLNLGD-LN
MW999640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999641_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999642_Pol_P-D      MPLSYQHFRSILLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999644_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999646_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MW999647_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999648_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGX-LN
MW999649_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999650_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999652_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999654_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999655_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999656_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999658_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097624_Pol_P-D      MPLSYPHFRKLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097625_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097626_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097627_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MZ097628_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MZ097630_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097631_Pol_P-D      MPLSYQHFRRLLLLDTE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097632_Pol_P-D      MPLSYQHFRRLLLLEDK--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MZ097633_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MZ097634_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097635_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097636_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
MZ097637_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MZ097638_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097639_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097640_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097641_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097642_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097643_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LS
MZ097644_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
MZ097645_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097646_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097647_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097648_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097650_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097651_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097653_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097654_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097655_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097656_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEXLNRRVAEDLNLGN-LN
MZ097657_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097658_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097659_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097660_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097662_Pol_P-D      MPLSYQHFRRLLLLDHT--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097663_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097664_Pol_P-D      MPLSYQHFLRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097665_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097666_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097668_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEELNLGN-LN
MZ097669_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097670_Pol_P-D      MPLSYHCFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097671_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MZ097672_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097673_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097674_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097675_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLHLGD-LN
MZ097676_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
MZ097677_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MZ097679_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097681_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097682_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097683_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-XN
MZ097684_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MZ097685_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LT
MZ097686_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097689_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097690_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097692_Pol_P-D      MPLSYQHFRRLLLLDEE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097693_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
MZ097694_Pol_P-D      MPLSYQHFRKLLLLDDE--TGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097695_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097696_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097697_Pol_P-D      MPLSYQCFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097698_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MZ097699_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEDELPRLADEGLNRRVAEDLNLGN-LN
MZ097700_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097701_Pol_P-D      MPLSYQHFRRLLLLDAX--AGXLEEELPRLADEGLNRRVAEDLNLGN-PN
MZ097702_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097704_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADQGLNRRVAEDLNLGD-LN
MZ097705_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
MZ097707_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LS
MZ097708_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097709_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGD-PN
MZ097710_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097711_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
MZ097712_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097713_Pol_P-D      MPLSYQHFRRLLLLDEE--SGPLEEELPRLADEGLNRRVAEDLNLGT-LT
MZ097714_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097715_Pol_P-D      MPLSYQHFRSVLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097717_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADQDLNRRVAEDLNLGN-LN
MZ097718_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097720_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097728_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGX-XN
MZ097729_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097730_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGT-LT
MZ097731_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097733_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097734_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097738_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097741_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097742_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097743_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097744_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097746_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097748_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097749_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097750_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEXELPRLADEDLNRRVAEDLNLGN-LN
MZ097751_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097752_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097754_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097755_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MZ097757_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097759_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097760_Pol_P-D      MPLSYRHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
MZ097761_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-PN
MZ097765_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LB
MZ097769_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097770_Pol_P-D      MPLSYQHFRRLVLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097771_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097772_Pol_P-D      MPLSYQHFRRLLLLDND--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097773_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097776_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097778_Pol_P-D      MPLSYQHFRRLLLLDDE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LH
MZ097779_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097780_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LX
MZ097782_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097784_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097785_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097786_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097787_Pol_P-D      MPLSYPHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097788_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097789_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097790_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097791_Pol_P-D      MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097794_Pol_P-D      MPLSYQRFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097795_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097796_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097797_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097798_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097799_Pol_P-D      MPLSYRRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
MZ097800_Pol_P-D      MPLSYQHFRKLLLLDXE--AGPLEEELPRLADEDLNRRVAEELNLGN-LN
MZ097801_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097802_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097803_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097804_Pol_P-D      MPLSYQHFRXLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097807_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097808_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLXLGN-LN
MZ097809_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
MZ097810_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097811_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097812_Pol_P-D      MPLSYQXFRRLLLLDHD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097813_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097815_Pol_P-D      MPLSYQHFXRLLLLDDE--AGPLEEELPRLADEDLNRRVAEELNLGN-LN
MZ097816_Pol_P-D      MPLSYHHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097817_Pol_P-D      MPLSYHHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097818_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097819_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097820_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097821_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
MZ097823_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGI-LN
MZ097824_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097825_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097827_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097828_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097829_Pol_P-D      MPLSYQHFRKLLLLEDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LS
MZ097830_Pol_P-D      MPLSYQHFRRLLLLEDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097832_Pol_P-D      MPLSYQHFRRLLLLDDD--TGPLEEELPRLAEEGLNRRVAEDLNLGN-PN
MZ097833_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097834_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097835_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
MZ097836_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097837_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PT
MZ097839_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097841_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097842_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097843_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097844_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
MZ097845_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097846_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097847_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097848_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
MZ097849_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097851_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097852_Pol_P-D      MPLSYQHFRRLLLLDAE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097853_Pol_P-D      MPLSYQHFRKLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097855_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097856_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097858_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097859_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097860_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097861_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097863_Pol_P-D      MPLSYQHFRRLLLLEDE--SGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097864_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097865_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097866_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097867_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
MZ097868_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097870_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097871_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LS
MZ097872_Pol_P-D      MPLSYQHFRKLLLLDDE--AGSLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097873_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPIEEELPRLADEGLNRRVAEDLNLGN-PN
MZ097874_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097875_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEDELPRLADEGLNRRVAEDLNLGN-LN
MZ097876_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097877_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGGNRRVAEDLNLGN-LN
MZ097878_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097879_Pol_P-D      MPLSYQHFRRLLLLDHE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097880_Pol_P-D      MPLSYQHFRRLLLLEEG--AGPLEEELPRLADQGLNRRVAEDLNLGN-LD
MZ097881_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097882_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097884_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
OK106256_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK143467_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVADDLNLGN-LN
OK143468_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVADDLNLGN-LN
OK143470_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK143472_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGD-LN
OK143473_Pol_P-D      MPLSYQHFRRLLLLEGE--AGPLEEELPRLADEGLNRRVADDLNLGN-LN
OK143474_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK143476_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
OK143479_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK143480_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVADDLNLGN-LN
OK143486_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK143488_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVADDLNLGN-LN
OK143489_Pol_P-D      MPLSYQHFRRLVLLDDD--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK143490_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK143496_Pol_P-D      MHLSYQHFRRLLLLEGE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK998519_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK998520_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK998521_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK998522_Pol_P-D      MPLSYQYFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OK998523_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK998524_Pol_P-D      MPLSYQQFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK998525_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OK998527_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLKEELPRLANEDLNRRVAKDLNLGN-LN
OM304306_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304307_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM304310_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304311_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304312_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304313_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM304314_Pol_P-D      MPLSYPHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304315_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-PN
OM304316_Pol_P-D      MPLSYQHFRRLLLLEDD--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM304317_Pol_P-D      MPLSYQHFRKLLLLDHE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM304318_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM304323_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLHLGD-LN
OM304324_Pol_P-D      MPLSYQHFRRLLLLDPE--AGPLEEELPRLADEGLNRRVAEELNLGN-LN
OM304325_Pol_P-D      MPLSYQHFRRLLLLDIE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721310_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721311_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721312_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721313_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721315_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
OM721316_Pol_P-D      MPLSYQRFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
ON585704_Pol_P-D      MPLSYQHFRKLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
X02496_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
X65257_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
X65258_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
X72702_Pol_P-D        MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
X80924_Pol_P-D        MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEDLNHRVAEDLNLGN-LN
X80926_Pol_P-D        MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEGLNHRVAEDLNLGN-LN
X85254_Pol_P-D        MPLSYQHFRRLLLLDDD--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
X97848_Pol_P-D        MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEDLNRRVAEDLNLWN-LN
X97849_Pol_P-D        MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
Y07587_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
Z35716_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
AB471856_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB471857_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AB210822_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAKDLNLGN-LN
MK507911_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK507913_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
AY161152_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
DQ486022_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELSHLADEGLNRRVAEDLNLGN-LN
JN664911_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668434_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668436_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668437_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668438_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KU668446_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
LC705462_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618339_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618341_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
V01460_Pol_P-D        MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
DQ336675_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
EU594405_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594413_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594410_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594427_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
JX096958_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594420_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594423_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
EU594431_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
FJ692507_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
FJ904421_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183450_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183451_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183453_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183454_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183456_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183462_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183464_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183466_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
GQ183469_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MF618342_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGT-LN
HQ700459_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700479_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700443_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700450_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700451_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700446_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700482_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700488_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
HQ700470_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439701_Pol_P-D      MPLPYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JF439705_Pol_P-D      MPLPYQHFRKLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JF439711_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-PN
JN792904_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN792909_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JN792910_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MT603401_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707482_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707496_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707500_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707502_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707508_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707503_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707527_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707514_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707518_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707520_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707521_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707522_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707528_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707517_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707688_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707695_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707696_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707685_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707690_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707692_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707697_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707700_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707704_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JQ707706_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC012652_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
JX898692_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196236_Pol_P-D      MPLSYQHFRRLVLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875308_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196234_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196216_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196217_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KC875323_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196224_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196225_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196221_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196218_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KX196232_Pol_P-D      MPLSYQHFRRLVLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF192832_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF471652_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584162_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF584164_Pol_P-D      MPLSYQRFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF679993_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
KT366497_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
KT366507_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPHLADEGLNRRVAEDLNLGN-LN
KF779285_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779296_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779303_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KF779229_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLSLGN-LN
MH724218_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724219_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366495_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366506_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366509_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
KT366500_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MG877727_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEXXLPRLABEGLNRRVAEDLNLGN-LN
MH724221_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724229_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MH724230_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK052975_Pol_P-D      MPLSYQHFRRLLLLEDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MK618421_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097722_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADPDLNRRVAEDLGLGN-LN
MZ097725_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LT
MZ097726_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097727_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097732_Pol_P-D      MPLSYQHFRRLLLLDNE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097735_Pol_P-D      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097736_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097747_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
MZ097753_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097756_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097763_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGD-LN
MZ097764_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097768_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097774_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097793_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097805_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999637_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999638_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999639_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999643_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999645_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999651_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MW999653_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
MZ097831_Pol_P-D      MPLSYQHFRKLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLGN-LN
OM721314_Pol_P-D      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEGLNRRVAEDLNLGN-LN
                                 :                                      

JN257177_Pol_P-D      VSIPWTHKVGSFTGFYSSTVPVFNPHWK-TPSFPXIHLHQDIIKKCEQFV
KF779220_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601281_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EF103281_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKQCEQFV
EU594404_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
GU456665_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310707_Pol_P-D      ASIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097737_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754588_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ922004_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
MK598675_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594401_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT749823_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594398_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477455_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477456_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
MN310706_Pol_P-D      ASIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707526_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX096957_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700472_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414135_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFX
JN040788_Pol_P-D      VSIPWTHKGGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787438_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601318_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097775_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
KJ647352_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456658_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456676_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792911_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB222710_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX357637_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664926_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIINKCEQFV
GQ167302_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
OM304322_Pol_P-D      VSIPWTHKVGTFTGLYSSTVPTFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688685_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594400_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524353_Pol_P-D      VSIPWTRKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603396_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPXFPNIHLHQDIIKKCEQFV
MT603383_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724247_Pol_P-D      VSIPWTHKGGXFTGLYSSTVPVFNPHWK-TPSFPNIHLQEAVIKKCEQFV
JN664948_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792903_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603392_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336680_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
LT992444_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPHIHLHQNIIKKCEQFV
AB674415_Pol_P-D      VSIPXTHKVGNFTGLYSSTVPVFXPHWK-TPSFPNIHLHQDIIKKCEQFV
KJ470885_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
AJ627218_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
AF043594_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
EU594426_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097840_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779230_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257173_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
JN257195_Pol_P-D      XSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
KM577670_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
KX827300_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK355501_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040820_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674424_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584165_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
L27106_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
OK143487_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB119255_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ399006_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN844882_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB188242_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792905_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674428_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524348_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
AB126581_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097883_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
LC365689_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598673_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598672_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097857_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPXWK-TPSFPNIHLHQDIIKKCEQFV
MT579903_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598671_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040769_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052952_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB090269_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MG877728_Pol_P-D      VSXPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQRCEQFV
MW601331_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX276857_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999632_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT114169_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601311_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSVPNIHLHQDIIKKCEQFV
DQ336691_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
MT603384_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB188241_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWE-TPFFPKIHLHQDIIKKCEQFV
KM524355_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIEKCEQFV
EU594424_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594425_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603397_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270542_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT579901_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
EU594408_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679997_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
EU594399_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183448_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097781_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
HQ700480_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB330369_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724246_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456678_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPTFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX096956_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601339_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601254_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX096954_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM025254_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097661_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627220_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097723_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603394_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925366_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIINKCEQFV
MW601338_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674431_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWRRRPSFPNIHLHQDTINKCEQFV
OM333239_Pol_P-D      VNIPWTHKAGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594428_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH464839_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
EU594402_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524347_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904429_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
ON585703_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601268_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456662_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB048701_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB090268_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB090270_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB104709_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB104710_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB104711_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB104712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB109475_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB109476_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
AB109477_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB109478_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB109479_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB110075_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB116266_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB119251_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB119252_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB119253_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPYWK-TPSFPNIHLHQDIIKKCEQFV
AB119254_Pol_P-D      VSIPWTHKVGNLTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB119256_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB120308_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB188244_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB205126_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB205127_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPTIHLHQDIIKKCEQFV
AB205128_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQGIIKKCEQFV
AB210820_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB210821_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB222709_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB222711_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB222712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB222713_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLPQDIIKKCEQFV
AB246347_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB246348_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB267090_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270539_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270541_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270543_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270546_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270547_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB270548_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDVIKKCEQFV
AB270550_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
AB330367_Pol_P-D      VSIPWTHKVGSFTGLYSSNVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB330370_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB493846_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB555496_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB555497_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB555500_Pol_P-D      ASIPWTHKVGNFTGLYSYNVPVFNPNWK-THSFPNIHLHEDIIKKCEQFV
AB555501_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB583680_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674405_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674406_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
AB674407_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
AB674408_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674411_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674416_Pol_P-D      VSIPWTHRVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
AB674419_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674420_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWR-RHSFPNIHLHQDIIKKCEQFV
AB674422_Pol_P-D      VSIPWXHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674423_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674425_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB674427_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AF121239_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
AF121240_Pol_C-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
AF121241_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
AF121242_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
AF151735_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AF280817_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ131956_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ344116_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627215_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627216_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627219_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627222_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
AJ627223_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
AJ627224_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AM422939_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY090452_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY090453_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY161150_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY161151_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY161157_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKRCEQFV
AY161158_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKRCEQFV
AY233291_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY233292_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY233294_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY233296_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY236160_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY236162_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY236164_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY661792_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TSSFPNIHLHQDIIKKCEQFV
AY661793_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TSSFPNIHLHQDIIKKCEQFV
AY721605_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY721606_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY721607_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY721609_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY721611_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIVKKCEQFV
AY741794_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY741795_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY741796_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY741797_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY741798_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY796030_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY796031_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHPDIIKKCEQFV
AY796032_Pol_P-D      VSIPWTHKVGNFTGLYSTTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY945307_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
DQ111986_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDVIKKCEQFV
DQ304547_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ304548_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFG
DQ304549_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ304550_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ304551_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ315776_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ329356_Pol_P-D      VRIPWTHKVGSFTGLYSSTGPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
DQ329357_Pol_P-D      VRIPWTHKVGSFTGLYSSTGPGFNPHWN-TSSFPNIHLHQDIIKKCEQFV
DQ336674_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336676_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336677_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336678_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336679_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336681_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336682_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336683_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336684_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336685_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336686_Pol_P-D      VSIPWAHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336687_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336688_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFA
DQ336689_Pol_P-D      VSTPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336690_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336692_Pol_P-D      VSIPWTHKVGSFTGLYSSTGPVFNPHWK-TPSFPYIHLHQDIIKKCEQFV
DQ464168_Pol_P-D      VSIPWAHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464169_Pol_P-D      VSIPWTHKEGDFTGLYSSTVPGFNPHWK-TPSFLNIHLHQDIIKKCEQFV
DQ464170_Pol_P-D      GRIPWTHKVGNFTGLYSSTDPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464172_Pol_P-D      VSYSWTHKVRSFTGLYSSTVPVFNPHWK-TPSFPNIHLPQDIIKKCEQFV
DQ464173_Pol_P-D      VSIPWTHKEGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464174_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464175_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464176_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464177_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464178_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464181_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ464182_Pol_P-D      GSIPWTHKVGTFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
DQ486021_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ486025_Pol_P-D      VSIPWTHKVGNFTGLYSSTEPIFNPHWK-TPSFPNIHLHQDIIRKCEQFV
EF103275_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
EF103276_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EF103277_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EF103279_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EF103280_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU155893_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
EU414136_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPYFPNIHLHQDIIKKCEQFV
EU414138_Pol_P-D      VSIPWTHKVGNFTGLYSSSXXVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414139_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414140_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414141_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414142_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU414143_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594382_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594396_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594397_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594403_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594407_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594409_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594414_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594415_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594416_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594417_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594418_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594419_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594421_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594422_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594429_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594430_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594432_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594433_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594434_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787436_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787437_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787440_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787441_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
EU787442_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
EU787443_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
EU787445_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787446_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU787447_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU919197_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU921418_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU921419_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU939680_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU939681_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349205_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHPDIIKKCEQFV
FJ349206_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349208_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
FJ349209_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349213_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349214_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349215_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
FJ349216_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
FJ349218_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349219_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
FJ349220_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
FJ349228_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
FJ349229_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349230_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
FJ349231_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
FJ349232_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349233_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIITKCEQFV
FJ349234_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ349235_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLPQDIIRKCEQFV
FJ386590_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ562309_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ562338_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ692506_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
FJ692532_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ692533_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ899792_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904395_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
FJ904399_Pol_P-D      VSIPWTHKVGNLTGLYSXTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904402_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904410_Pol_P-D      VSIPWTHKVGQFTGLYSSTEPVFNPHWK-TPSFPNIHLHQDIIXRCEQFV
FJ904412_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904415_Pol_P-D      VSIRWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904418_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
FJ904419_Pol_P-D      VSIPWTHKVGNLTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
FJ904420_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904422_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
FJ904424_Pol_P-D      VSIPWTHKVGHFTGFYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904426_Pol_P-D      ASIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904427_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904431_Pol_P-D      DSIPWTHKVGNLAGLXSSTVPVINPXWK-TPSFPNIHLHQDIIKKCEQFV
FJ904432_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
FJ904433_Pol_C-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
FJ904435_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDVIKRCEQFV
FJ904438_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904439_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904443_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ904445_Pol_P-D      VSIPWTHKVGTFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
FJ904446_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ167301_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
GQ183449_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183452_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183455_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183457_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183458_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183459_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183460_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183461_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183463_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPIIHLHQDIIKKCEQFV
GQ183465_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183467_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183468_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183470_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183471_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183472_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183473_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183474_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183475_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183476_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183478_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183479_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183481_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183482_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183483_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183484_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ184322_Pol_P-D      VSIPWTHKVGNFTGLYPSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
GQ205380_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
GQ205382_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIINKCEQFV
GQ205384_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
GQ205385_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
GQ205388_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCGQFV
GQ205389_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
GQ377589_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477452_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477453_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477457_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477458_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ477459_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ922000_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPHIHLHQDIIKKCEQFV
GQ922001_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
GQ922002_Pol_P-D      VSIPWTHKEGNFTGLYSSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
GQ922003_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
GQ922005_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
GQ924652_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU357846_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456635_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456636_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
GU456637_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWQ-TPSFPNIHLHQDIIKKCERFV
GU456638_Pol_P-D      VSVPWTHKVGNLTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
GU456639_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456641_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456643_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDLIKKCEQFV
GU456645_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456646_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456647_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456648_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456649_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456650_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456651_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
GU456652_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456653_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPRWK-TPSFPNIHLHQDIIKKCEQFV
GU456654_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456655_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEHFV
GU456656_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456657_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
GU456659_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456660_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
GU456661_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456663_Pol_P-D      ASIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456664_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456666_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
GU456667_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
GU456668_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456669_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456670_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
GU456671_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456673_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456674_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
GU456675_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456677_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456679_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
GU456680_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456681_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GU456682_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFA
GU456683_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
GU456684_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQLV
HM750151_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HM750152_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPTIHLHQDIIKKCEQFV
HM750153_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPSIHLHQDIIKKCEQFV
HM750154_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HM750155_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HM750156_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ236014_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ236015_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ236016_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700440_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700441_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700442_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700444_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700445_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700447_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700448_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700449_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700454_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700455_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700458_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700463_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700464_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700466_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700469_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700471_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700473_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700474_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700477_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700478_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700481_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700483_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700484_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700487_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700510_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
HQ700511_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700512_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
HQ700513_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
HQ700514_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
HQ700553_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ833465_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLNQDIIKKCEQFV
HQ833467_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIINKCEQFV
HQ833468_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ833469_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ833470_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ833471_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
JF439692_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439693_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439694_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439695_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439696_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439699_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439700_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439702_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439703_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439704_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439706_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439707_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439708_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439709_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439710_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439713_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439716_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439717_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439718_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439719_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754590_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754591_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
JF754592_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
JF754593_Pol_P-D      VSVPWTHKVGTFTGLYSSTVPVFNPHGK-TPSFPNIHLHQDIIKKCEQFV
JF754594_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754595_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754596_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754597_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754598_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754599_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
JF754600_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JF754601_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754602_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754603_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754604_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754606_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
JF754607_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQLV
JF754609_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754610_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
JF754611_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
JF754612_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHEDIIKKCEQFV
JF754614_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754615_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754617_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQKCEQFV
JF754618_Pol_P-D      VSIPWTHKVGNFXGLYSSTVPVFNPHGK-TPSFPNIHLHQDIIKKCEQFV
JF754619_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754621_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPTIHLHQDIIKKCEQFV
JF754622_Pol_P-D      VDIPWTHKVGNLTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754623_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
JF754624_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754626_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754627_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754628_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754629_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754630_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF754631_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHGK-TPSFPNIHLHQDIIKKCAQFV
JF754632_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
JF754633_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
JF754634_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQNIIEKCEQFV
JF754635_Pol_P-D      VSIPWTHKVGNITGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040750_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040751_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040753_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040755_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040756_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040757_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040758_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040759_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040761_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040762_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
JN040765_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040766_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040767_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
JN040768_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEHFV
JN040770_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040771_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040773_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040774_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040775_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040777_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
JN040778_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040779_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
JN040781_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKRCEQFV
JN040782_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
JN040783_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040784_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIVKKCEQFV
JN040785_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
JN040786_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040787_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040790_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN040791_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040792_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040793_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040794_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040795_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040796_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040797_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN040799_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040800_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040801_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040802_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040805_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
JN040806_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN040807_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
JN040808_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040809_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040810_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
JN040811_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040812_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040813_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWQ-TPSFPNIHLHQDIIKKCEQFV
JN040814_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040815_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040818_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFA
JN040819_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040821_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040822_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040823_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040824_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040826_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040827_Pol_P-D      VSIPWTHKVGNFTGLYSATVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040828_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040829_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN040830_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257148_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257149_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257150_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN257151_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
JN257152_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257153_Pol_P-D      XSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
JN257155_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257159_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257160_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257162_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257163_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257165_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257166_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257169_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257170_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257171_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257172_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
JN257176_Pol_P-D      VSIPWTHKVGSFTGFYSSTVPVFNPHWK-TPSFPXIHLHQDIIKKCEQFV
JN257179_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257181_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257182_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257183_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257185_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257186_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257187_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257188_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257190_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257193_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257196_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257199_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257200_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257201_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257202_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257203_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257205_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN257209_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642126_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
JN642128_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642129_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642130_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642131_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642132_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642133_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN642134_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642135_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642136_Pol_P-D      VSTPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642138_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642140_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642142_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642143_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642144_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642145_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642146_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
JN642147_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
JN642148_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642149_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642150_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642151_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642153_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642154_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642155_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642156_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642157_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642158_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642159_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642161_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642163_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642165_Pol_P-D      VSIPWTHMVGNFTGLYSSTVPVFTPHWK-TPSFPTIHLHQDIIKKCAQFV
JN642166_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN642167_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664909_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
JN664910_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIEKCEQFV
JN664912_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664913_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664914_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664917_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664918_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
JN664919_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPHIHLHQDIIKKCEQFV
JN664920_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPDWQ-TPSFPHIHLKEDIINRCEQFV
JN664921_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPDWQ-TPSFPHIHLKEDIINRCQQFV
JN664922_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPDWK-TPSFPHIHLKEDIINRCQQFV
JN664927_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664930_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664931_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
JN664932_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664936_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664937_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664938_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664939_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664941_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688678_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688679_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688683_Pol_P-D      VSIPWTHKVGNLAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
JN688695_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688708_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688710_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688711_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN688713_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792906_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792907_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792908_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792912_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ687530_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ687531_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
JQ707476_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707478_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707479_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707480_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707481_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707483_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707485_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707486_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707487_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707488_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707489_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707490_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707491_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707493_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707494_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707497_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707499_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707505_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707507_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707512_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707513_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707515_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707516_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707519_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707523_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707524_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707525_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707529_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707530_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-IPSFPNIHLHQDIIKKCEQFV
JQ707682_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707683_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707684_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707686_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707687_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707689_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707691_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707693_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
JQ707694_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707698_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLYQDIIKKCEQFV
JQ707699_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707701_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707702_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707703_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707705_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ927384_Pol_P-D      VDIPWTHKVGNFTGLYSTTVPVFNPHWK-TPSFPNIHLHQDIIDKCEQFV
JX096955_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX470760_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX898689_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX898691_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX898694_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX898697_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875275_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875276_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875277_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875278_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875279_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875280_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875281_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875282_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875283_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875284_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875285_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875286_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875287_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875288_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875289_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875290_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875291_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875292_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875293_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875294_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875295_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875296_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875297_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875299_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875300_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875301_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875302_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875303_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875304_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875305_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875306_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875309_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875310_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875311_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875312_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875313_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875316_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875317_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875319_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875320_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875321_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875322_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875324_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875325_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875328_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875329_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875330_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875331_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875332_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875333_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875334_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875335_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875336_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875337_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875340_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
KC875342_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
KF053178_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF061167_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF061168_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF061169_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF061170_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF192830_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KF192831_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KF192834_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KF471640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471641_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471642_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471644_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471645_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
KF471646_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471647_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471649_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
KF471650_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471651_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471654_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471655_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471656_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
KF471657_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471658_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF471659_Pol_P-D      VSIPWTHKVGNFMGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
KF471660_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584160_Pol_P-D      VSIPWTHKVGNFTGLYSXTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584161_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584163_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584166_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679989_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIVKKCEQFV
KF679990_Pol_P-D      VSIPWTHKVGNFSGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
KF679992_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679994_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679995_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679996_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679998_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779209_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779212_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779214_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779216_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779217_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779218_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779219_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779222_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779223_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779224_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779225_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779228_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779288_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779289_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779292_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779301_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779302_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779318_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779340_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
KF779341_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
KF779376_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779377_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779382_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF922432_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPSIHLHQDIIKKCEQFV
KJ470889_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KJ470893_Pol_P-D      VSIPWTHKVGNFTGFYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KJ470894_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KJ470895_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KJ470896_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KJ647350_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KJ647353_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KJ647355_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KJ843187_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM519455_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524338_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKRCEQFV
KM524339_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524340_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIINKCEQFV
KM524342_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
KM524344_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524345_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIINKCEQFV
KM524346_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524349_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524350_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524351_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524352_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524354_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
KM524356_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM524358_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
KM524361_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM577668_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM577669_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM577671_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606744_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606745_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606752_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606753_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606754_Pol_P-D      VSITWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KM606755_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP090177_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP090178_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP090179_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP090180_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP090181_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP168419_Pol_P-D      VDIPWTHKVGNFTGLYSTTVPVFNPHWK-TPSFPNIHLHQDIIDKCEQFV
KP322599_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP322600_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP322601_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KP995100_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KR905423_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KR905424_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT151620_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT347090_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366465_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366491_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366493_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366494_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366496_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366498_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366499_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366501_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366502_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366508_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366510_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366511_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT749821_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT749827_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT749828_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHPDIIKKCEQFV
KT963508_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWN-TPSFPNIHLHQDIIKKCEQFV
KU668433_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCGQFV
KU668435_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCGQFV
KU668439_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIEKCEQFV
KU668441_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668442_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668444_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668445_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668447_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668448_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668449_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU736924_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU736925_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU736926_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU736927_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196208_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196209_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196210_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196211_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196212_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196213_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196214_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196215_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196219_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196220_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196226_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196227_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196228_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196229_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
KX196230_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196231_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196233_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196235_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX276856_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX357622_Pol_P-D      VDIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX357638_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX357639_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX827290_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX827291_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX827292_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX827301_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KY382412_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KY382414_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KY629630_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KY629633_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KY629634_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCERFV
LT992454_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
M32138_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF488704_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618340_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618343_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618348_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618349_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925358_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925363_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925364_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925379_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925383_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF925391_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MF925393_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MG877709_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MG877718_Pol_P-D      VSIPWTHKVGXFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MG877719_Pol_P-D      VSIPWTHKVGXFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MG877720_Pol_P-D      VSIPWTHKVGXFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MG877726_Pol_P-D      VSXPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQRCEQFV
MH464841_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPHWK-TPSFPNIHLXQDIIKKCEQFV
MH724214_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MH724215_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724216_Pol_P-D      VXIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724217_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724220_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724223_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724224_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724225_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724226_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724227_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724228_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724231_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724232_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724233_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724234_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIITRCEQFV
MH724235_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724236_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724237_Pol_P-D      VSIPWTHKVGNLTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724238_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724241_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724242_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724244_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724245_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
MH724248_Pol_P-D      VSIPWTHKVGXFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724249_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724250_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724251_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
MH724252_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH932714_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052947_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052948_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052949_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052950_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052951_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052953_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052954_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052955_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052956_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052958_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052959_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052960_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052961_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052963_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052966_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052971_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052972_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052973_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052974_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK355500_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK507910_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK507912_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK507914_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK516278_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK541688_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEDFV
MK598636_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598637_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598638_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598639_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLNQDIIKKCEQFV
MK598640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598641_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598642_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598643_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598644_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598645_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPYFPKIHLHQDIIKKCEQFV
MK598646_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598647_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598648_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDVIKKCEQFV
MK598649_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDVIKKCEQFV
MK598650_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598651_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598655_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598657_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598658_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598659_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPTIHLHQDIIKKCEQFV
MK598660_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598661_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598662_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598663_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598664_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598665_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598666_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598667_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598668_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598669_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598670_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598674_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK598676_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MK598677_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MK598678_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MK598679_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MK618418_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618419_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618420_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618422_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618423_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618424_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618425_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618426_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618427_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618428_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618429_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MK618430_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MK618431_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLPQDIIKKCEQFV
MK618432_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MK618433_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MK618434_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618435_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618436_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618437_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLPQDIIKKCEQFV
MK618441_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618443_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK693107_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIRLHQEIIKKCEQFV
MK693108_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK693109_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310705_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310708_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310709_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHFHQDIIKNCEQFV
MN310710_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310711_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310713_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310714_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN310715_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507836_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507837_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507838_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507839_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507851_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507852_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN507853_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN839643_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MN844881_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MT114172_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT114173_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT579898_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT579899_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT579900_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
MT579902_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT591276_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MT591277_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MT591278_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT591279_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT591281_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MT603387_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
MT603388_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
MT603389_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603390_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603391_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603393_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MT603395_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603398_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603399_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPXFPNIHLHQDIIKKCEQFV
MT603400_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603402_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603403_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603404_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW082640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW455166_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601228_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601229_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601231_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIVKRCEQFV
MW601232_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601233_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601234_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
MW601236_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601237_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601238_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601239_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601242_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601243_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601244_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601245_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MW601246_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHPDIIKKCEQFV
MW601247_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601248_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601249_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601250_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
MW601251_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIRKCEQFV
MW601252_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601253_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601255_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIEKCEQFV
MW601256_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601257_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601258_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
MW601259_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601261_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601262_Pol_P-D      VSVPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601263_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601265_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601266_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601267_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601269_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601271_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MW601272_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601273_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601274_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601275_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601276_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPDWK-TPSFPNIHLHQDIIKKCEQFV
MW601278_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601279_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601280_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601282_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601283_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601285_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601286_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601287_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MW601288_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFA
MW601289_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601290_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601291_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601292_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601293_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MW601294_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601295_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MW601297_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601298_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCERFV
MW601299_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601300_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MW601301_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601302_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601303_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601305_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601306_Pol_P-D      VDIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601307_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
MW601308_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQKCEQFV
MW601309_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDLIKKCEQFV
MW601312_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601313_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601314_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPSWK-TPSFPNIHLHQDIINKCEQFV
MW601315_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601316_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MW601319_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601320_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPAFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601321_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601323_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIYKCEQFV
MW601324_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
MW601325_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601326_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601327_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSQWK-TPSFPNIHLHQDIIKKCEQFV
MW601328_Pol_P-D      VSIPWTHKVGNFTGLYSSTTPVFNPNWK-TPSFPNIHLHQNIIQRCEQFV
MW601329_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601330_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601332_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNTHWK-TPSFPNIHLHQDIIKKCEQFV
MW601333_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601334_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601335_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601336_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW601337_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW675897_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW675898_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW847931_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPXIHLHQDIIKKCEQFV
MW999631_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999634_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999635_Pol_P-D      VSIPWTHKVGNFAGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999636_Pol_P-D      VSIPWTHRVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999641_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999642_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MW999644_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDVIKKCEQFV
MW999646_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
MW999647_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999648_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPXIHLHQDIIKKCEQFV
MW999649_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MW999650_Pol_P-D      VRIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999652_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999654_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999655_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEHFV
MW999656_Pol_P-D      VNIPWTHKVGNHTGLYSSTVPVFNPHWK-TPSFPNIHLNQDIIKKCEQFV
MW999658_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLQQDIIKRCEQFV
MZ097624_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097625_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIITKCEQFV
MZ097626_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNXHLHQDIIKKCEQFV
MZ097627_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
MZ097628_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097630_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097631_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097632_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097633_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097634_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097635_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097636_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
MZ097637_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097638_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097639_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MZ097640_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097641_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097642_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097643_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097644_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPQWK-TPSFPNIHLHQDIIKKCEQFV
MZ097645_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097646_Pol_P-D      VSIPWTHKVGTFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097647_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097648_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097650_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097651_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHSDIIKKCEQFV
MZ097653_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097654_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPKIHLHQDIINKCEQFV
MZ097655_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097656_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPXWK-TPSFPNIHLHQDIIKKCEQFV
MZ097657_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
MZ097658_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
MZ097659_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097660_Pol_P-D      ANIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097662_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097663_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097664_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097665_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIVKKCEQFV
MZ097666_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097668_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097669_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPTFPNIHLHQDIIKKCEQFV
MZ097670_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPXIHLHQDIIKKCEQFV
MZ097671_Pol_P-D      VSIPXTHKVGNFTGLYSSTVPVYNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097672_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097673_Pol_P-D      VSIPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097674_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097675_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097676_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097677_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MZ097679_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097681_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097682_Pol_P-D      VXIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097683_Pol_P-D      VSIPWTHRVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097684_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097685_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097686_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097689_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097690_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097692_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLNQDIIKKCEQFV
MZ097693_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097694_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097695_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097696_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQXV
MZ097697_Pol_P-D      VSVPXTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIZKCEQFV
MZ097698_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPQWK-TPSFPNIHLHQDIIKRCEQFV
MZ097699_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPLFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097700_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097701_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQKCEQFV
MZ097702_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097704_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097705_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIVKKCEQFV
MZ097707_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097708_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097709_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIEKCEQFV
MZ097710_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097711_Pol_P-D      VSIPWTHKVGNFAGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097712_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097713_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCENFV
MZ097714_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097715_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MZ097717_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097718_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097720_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
MZ097728_Pol_P-D      VSVPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MZ097729_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHPDIIKKCEQFV
MZ097730_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
MZ097731_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097733_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097734_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
MZ097738_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097741_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097742_Pol_P-D      VSVPCTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097743_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MZ097744_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPBIHLHQDIIKKCEQFV
MZ097746_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097748_Pol_P-D      VSIPWTHKVGNFTGLYSSNVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MZ097749_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097750_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097751_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPHIHLHQDIIKKCEQFV
MZ097752_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097754_Pol_P-D      VSIPWTHKVGNXTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIXKCEQFV
MZ097755_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097757_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097759_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097760_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIXLHQDIIXKCEQFV
MZ097761_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097765_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097769_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCERFV
MZ097770_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097771_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MZ097772_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097773_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097776_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQKCEQFV
MZ097778_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097779_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097780_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097782_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097784_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQBIIYKCEQFV
MZ097785_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097786_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097787_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQLV
MZ097788_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097789_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQKCEQFV
MZ097790_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097791_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097794_Pol_P-D      VSIPWTHKVGNFTGLYSSTTPVFNPNWK-TPSFPNIHLHQNIIQRCEQFV
MZ097795_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKRCEQFV
MZ097796_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPFFPNIHLHQDIIKKCEQFV
MZ097797_Pol_P-D      VXIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNXHLHQDIIKKCEQFV
MZ097798_Pol_P-D      VSIPWTHKVGNFXGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097799_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097800_Pol_P-D      VSIPWTHXVGNFXGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097801_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MZ097802_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
MZ097803_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPYWK-TPSFPNIHLHQDIIKKCEQFV
MZ097804_Pol_P-D      VSIPWTHKVGXFXGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MZ097807_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097808_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097809_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097810_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097811_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097812_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097813_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097815_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097816_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097817_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097818_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPTIHLHQDIIKKCEQFV
MZ097819_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097820_Pol_P-D      VSIPWTHKVGNFTGLYSSXVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097821_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097823_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097824_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MZ097825_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097827_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097828_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097829_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
MZ097830_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097832_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097833_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097834_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097835_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPKIHLHQDIIKKCEQFV
MZ097836_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097837_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097839_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097841_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097842_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097843_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097844_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097845_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097846_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097847_Pol_P-D      VSIPWTHKVGNFTGLYSSTIPVFNPNWK-TPSFPNIHLHQDIIKKCEHFV
MZ097848_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHVHQDIIKKCEQFV
MZ097849_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097851_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097852_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097853_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097855_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097856_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097858_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097859_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
MZ097860_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWT-TPSFPNIHLHQDIIKKCEQFV
MZ097861_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097863_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097864_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWE-TPSFPNIHLHQDIIQKCEQFV
MZ097865_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097866_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPCFPNIHLHQDIIKKCEQFV
MZ097867_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
MZ097868_Pol_P-D      VSIPWTHKVGNLTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097870_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHXDIIKRCEQFV
MZ097871_Pol_P-D      VSIPWTHKVGNFTGLYSSXXPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
MZ097872_Pol_P-D      VSIPWTHKVGNFTGLYSSTLPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097873_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097874_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097875_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097876_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097877_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097878_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097879_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097880_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097881_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097882_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097884_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLXQDIINKCEQFV
OK106256_Pol_P-D      VSIPWTHKXGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143467_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143468_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143470_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143472_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
OK143473_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143474_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPDIHLHQDIIKKCEQFV
OK143476_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-PPSFPNIHLHQDIIKKCEQFV
OK143479_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIRKCEQFV
OK143480_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143486_Pol_P-D      VSIPWTHKVGNFTGLYSSSIPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143488_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143489_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143490_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK143496_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998519_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998520_Pol_P-D      VSIPWTHKVGNFTGLYSSSGRVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998521_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998522_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998523_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998524_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998525_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OK998527_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304306_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304307_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNILLHQDIIKKCEQFE
OM304310_Pol_P-D      VSIPWTHKVGNFTGLYSSAVPVFNPHWK-TPSFPNIHLHQDIIKRCERFV
OM304311_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
OM304312_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
OM304313_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304314_Pol_P-D      VSIPWTHKVGNFTGLYSSTAPVFNPNWK-TPSFPNIHLHQDIIKKCEQFV
OM304315_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304316_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304317_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304318_Pol_P-D      VSIPWTHKVGNFTGLYSSSVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304323_Pol_P-D      VNIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304324_Pol_P-D      VSIPWTHKVGNFSGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM304325_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM721310_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM721311_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM721312_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
OM721313_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM721315_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIKKCEQFV
OM721316_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
ON585704_Pol_P-D      VSIPWTHKVGNXTGXYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
X02496_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
X65257_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
X65258_Pol_P-D        VSIPWTHKVGNFTGFYSSTVPVFNPHWE-TPSFPNIHLHQDIIKKCEQFV
X72702_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
X80924_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
X80926_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
X85254_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
X97848_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCEQFV
X97849_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
Y07587_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
Z35716_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
AB471856_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB471857_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AB210822_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK507911_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK507913_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
AY161152_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ486022_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN664911_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668434_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668436_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668437_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668438_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KU668446_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
LC705462_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618339_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618341_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
V01460_Pol_P-D        VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
DQ336675_Pol_P-D      VSIPWTHKVGSFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594405_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594413_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594410_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594427_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX096958_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594420_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594423_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
EU594431_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
FJ692507_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLRQDIIKKCEQFV
FJ904421_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183450_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183451_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183453_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183454_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183456_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183462_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183464_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183466_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
GQ183469_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MF618342_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIINKCGQFV
HQ700459_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700479_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700443_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700450_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700451_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700446_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700482_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700488_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
HQ700470_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPIFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439701_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439705_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JF439711_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792904_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792909_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JN792910_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MT603401_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707482_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707496_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707500_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707502_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707508_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707503_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707527_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707514_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707518_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707520_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707521_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707522_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707528_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707517_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707688_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707695_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707696_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707685_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707690_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707692_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707697_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707700_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707704_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JQ707706_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC012652_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
JX898692_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196236_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875308_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196234_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196216_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196217_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KC875323_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196224_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196225_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196221_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196218_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KX196232_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF192832_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQNIIEKCEQFV
KF471652_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584162_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF584164_Pol_P-D      VSIPWTHKVGNFTGLYSSTXPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF679993_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366497_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366507_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779285_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779296_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779303_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KF779229_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724218_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724219_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366495_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366506_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366509_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
KT366500_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MG877727_Pol_P-D      VSXPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIQRCEQFV
MH724221_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKRCEQFV
MH724229_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MH724230_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK052975_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MK618421_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097722_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097725_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097726_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097727_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097732_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097735_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIRKCEQFV
MZ097736_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097747_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097753_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097756_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097763_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097764_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097768_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097774_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097793_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNSQWK-TPSFPNIHLHQDIIKKCEQFV
MZ097805_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999637_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999638_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999639_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999643_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999645_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999651_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MW999653_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
MZ097831_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEQFV
OM721314_Pol_P-D      VSIPWTHKVGNFTGLYSSTVPVFNPHWK-TPSFPNIHLHQDIIKKCEHFV
                            :      *  .       .       .    .    : .*    

JN257177_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KF779220_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MW601281_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EF103281_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594404_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456665_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
MN310707_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097737_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JF754588_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHIVNHYFQTRH
GQ922004_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK598675_Pol_P-D      GPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594401_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KT749823_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594398_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ477455_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
GQ477456_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKATKYLPLDKGIKPYYPEHLVNHYFQTRH
MN310706_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JQ707526_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JX096957_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700472_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
EU414135_Pol_P-D      GXLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN040788_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
EU787438_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKSTKYLPLDKGIKPYYPEHLVNHYFQTRH
MW601318_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097775_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKITKYLPLDKGIKPYYPEHLVNHYYQTRH
KJ647352_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456658_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456676_Pol_P-D      GPLTTNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN792911_Pol_P-D      GPLTVNEKRRLKLVMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB222710_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KX357637_Pol_P-D      GPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN664926_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ167302_Pol_P-D      GPLTVNEKRRLQLVMPARFYPKVTKYLPWDKGIKPYYPEHLVYHYFQTRD
OM304322_Pol_P-D      GPLTINEKRILQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN688685_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594400_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KM524353_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603396_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603383_Pol_P-D      GPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MH724247_Pol_P-D      GPLTAKGKRRLRLIMPARFYPNVTKDLPLDKGIKPYYPEHLVNHDFQTRH
JN664948_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN792903_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603392_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336680_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
LT992444_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNCTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674415_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KJ470885_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627218_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF043594_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594426_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097840_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KF779230_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN257173_Pol_P-D      GPLTVNEKRRLQLIMPARFXPNVTKYLPLDKGIKPYYPNHLVNHYFQTRH
JN257195_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRH
KM577670_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KX827300_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK355501_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTGH
JN040820_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674424_Pol_P-D      GPLTVNEKRRLQLVMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KF584165_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
L27106_Pol_P-D        GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPENLVNHYFQARH
OK143487_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119255_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ399006_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARH
MN844882_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFHTRH
AB188242_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN792905_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674428_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQXRH
KM524348_Pol_P-D      GPLTVNEKRRLQLIMPAKFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB126581_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097883_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
LC365689_Pol_P-D      GPLTXNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK598673_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK598672_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097857_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHXVNHYFQTRH
MT579903_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK598671_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JN040769_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MK052952_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB090269_Pol_P-D      GPLTVNENRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MG877728_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVDHYFHTRH
MW601331_Pol_P-D      GPLTVNEKRRLQLVMPARFYPKCTKYLPLDKGIKPYYPEHLVNHYFQTRH
KX276857_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPXDKGIKPYYPEHLVNHYFQTRH
MW999632_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT114169_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFHTRH
MW601311_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHIVNHYFQTRH
DQ336691_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603384_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB188241_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KM524355_Pol_P-D      GPLTVNEKRRIQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594424_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594425_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603397_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270542_Pol_P-D      GPLTVNEKRRLXLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT579901_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594408_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KF679997_Pol_P-D      GPLTVNEKRRLHLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594399_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183448_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRP
MZ097781_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700480_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB330369_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MH724246_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456678_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JX096956_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MW601339_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQPRH
MW601254_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
JX096954_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
OM025254_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097661_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
AJ627220_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MZ097723_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MT603394_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MF925366_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
MW601338_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674431_Pol_P-D      GPLTGNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
OM333239_Pol_P-D      GPLTVDEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLANHYFPTRH
EU594428_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MH464839_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594402_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
KM524347_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904429_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
ON585703_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
MW601268_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQARH
GU456662_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB048701_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFHTRH
AB090268_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB090270_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
AB104709_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB104710_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB104711_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB104712_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB109475_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB109476_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB109477_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB109478_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB109479_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB110075_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB116266_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119251_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119252_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119253_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119254_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB119256_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB120308_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB188244_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB205126_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB205127_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB205128_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB210820_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB210821_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB222709_Pol_P-D      GPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRH
AB222711_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB222712_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB222713_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB246347_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB246348_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB267090_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270539_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270541_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270543_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270546_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270547_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270548_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB270550_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB330367_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB330370_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB493846_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB555496_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB555497_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB555500_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB555501_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB583680_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674405_Pol_P-D      GPLTVNEKRRLQWIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674406_Pol_P-D      GPLTVNEKRRLQMIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674407_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674408_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674411_Pol_P-D      GPLTVNEKRRLQLVMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674416_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNXTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674419_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674420_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674422_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674423_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674425_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AB674427_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF121239_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF121240_Pol_C-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF121241_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF121242_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF151735_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AF280817_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEYLVNHYFQTRH
AJ131956_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ344116_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627215_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627216_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627219_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627222_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLEKGIKPYYPEHLVNHYFQTRH
AJ627223_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AJ627224_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AM422939_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY090452_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY090453_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY161150_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRH
AY161151_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRH
AY161157_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY161158_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY233291_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
AY233292_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFKTRH
AY233294_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFKTRH
AY233296_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFKTRH
AY236160_Pol_P-D      GPLTVNEKRRLKLIMPARVYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
AY236162_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY236164_Pol_P-D      GPLTVNEKRRLKLIMPARVYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
AY661792_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY661793_Pol_P-D      GQLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY721605_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY721606_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY721607_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY721609_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNQYFQTRH
AY721611_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY741794_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY741795_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY741796_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY741797_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY741798_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY796030_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY796031_Pol_P-D      GPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
AY796032_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
AY945307_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ111986_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ304547_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ304548_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTNNLPLDKGIKPYYPEHLVNHYFQTRH
DQ304549_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ304550_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ304551_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQHRH
DQ315776_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ329356_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ329357_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336674_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336676_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336677_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336678_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336679_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336681_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336682_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
DQ336683_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
DQ336684_Pol_P-D      GPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
DQ336685_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336686_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336687_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336688_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336689_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336690_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ336692_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464168_Pol_P-D      GPLTVNEKSRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464169_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464170_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464172_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464173_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464174_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464175_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464176_Pol_P-D      GPLTVNEKRRLKLIMPARYYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464177_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464178_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPHYPEHLVNHYFQTRH
DQ464181_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ464182_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ486021_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRH
DQ486025_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQARH
EF103275_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EF103276_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNSYFQTRH
EF103277_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EF103279_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EF103280_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU155893_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414136_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNITKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414138_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414139_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414140_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414141_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414142_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU414143_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594382_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594396_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594397_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594403_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594407_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594409_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594414_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594415_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594416_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594417_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594418_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594419_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594421_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594422_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594429_Pol_P-D      GPLTVNEKRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594430_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594432_Pol_P-D      GPLTVNEKRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594433_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU594434_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787436_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787437_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787440_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787441_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787442_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787443_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787445_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVYHYFQTRH
EU787446_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNITKYLPLDKGIKPYYPEHLVNHYFQTRH
EU787447_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU919197_Pol_P-D      GPLTVNEKRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU921418_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU921419_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU939680_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
EU939681_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349205_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349206_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
FJ349208_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349209_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349213_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349214_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349215_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349216_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349218_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349219_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRH
FJ349220_Pol_P-D      GPLTVNEKRRLRLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349228_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349229_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349230_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349231_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349232_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349233_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349234_Pol_P-D      GPLTVNEKRRLHLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ349235_Pol_P-D      GPLTVNEKRRLRLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ386590_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ562309_Pol_P-D      GPLTVNEKRRLQLVMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ562338_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ692506_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ692532_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ692533_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ899792_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904395_Pol_P-D      GPLTXNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904399_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904402_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904410_Pol_P-D      GPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKSYYPEHLVNHYFQTRH
FJ904412_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904415_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904418_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904419_Pol_P-D      GPLTINEKRRLKLIMPARFYPKRTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904420_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904422_Pol_P-D      GPLTINEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904424_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904426_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904427_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHIVNHYYQTRH
FJ904431_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904432_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904433_Pol_C-D      GPLTANEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904435_Pol_P-D      GPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904438_Pol_P-D      GPLTINEKRRLKLIMPARFYPNCTKYLPLDKGIKPYYPEHVVNHYFQTRH
FJ904439_Pol_P-D      GPLTINEKRRLKLIMPARFYPKFTKYLPLDKGIKPYYPEHIVNHYFQTRH
FJ904443_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904445_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
FJ904446_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ167301_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRD
GQ183449_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183452_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183455_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183457_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183458_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKNLPLDKGIKPYYPEHLVNHYFQTRH
GQ183459_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183460_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183461_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKNLPLDKGIKPYYPEHLVNHYFQTRH
GQ183463_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183465_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183467_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183468_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183470_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183471_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183472_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183473_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183474_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183475_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183476_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183478_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183479_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183481_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183482_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183483_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ183484_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ184322_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRD
GQ205380_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ205382_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ205384_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ205385_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ205388_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ205389_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ377589_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ477452_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ477453_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ477457_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARH
GQ477458_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKGTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ477459_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ922000_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ922001_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ922002_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ922003_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ922005_Pol_P-D      GPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GQ924652_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU357846_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456635_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456636_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456637_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456638_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456639_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456640_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456641_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456643_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456645_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456646_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456647_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456648_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456649_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456650_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456651_Pol_P-D      GPLTVNEKRRLQLILPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456652_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456653_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456654_Pol_P-D      GPLTVNEKRRLNLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
GU456655_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456656_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456657_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYFPLDKGIKPYYPEHLVNHYFQTRH
GU456659_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456660_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456661_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456663_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456664_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456666_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456667_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456668_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456669_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLEKGIKPYYPEHLVNHYFQTRH
GU456670_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456671_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456673_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456674_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456675_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456677_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPENLVNHYFQTRH
GU456679_Pol_P-D      GPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRH
GU456680_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456681_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456682_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456683_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
GU456684_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HM750151_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HM750152_Pol_P-D      GPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HM750153_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLGKGIKPYYPEHLVNHYFQTRH
HM750154_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HM750155_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HM750156_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ236014_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ236015_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ236016_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700440_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700441_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700442_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700444_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700445_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700447_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700448_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700449_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700454_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700455_Pol_P-D      GPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700458_Pol_P-D      GPLTVNEKRRLKLIMPARFYPKFTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700463_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700464_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700466_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700469_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700471_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700473_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700474_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700477_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700478_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRH
HQ700481_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRH
HQ700483_Pol_P-D      GPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPY