HBVdb

Dataset for protein HBe of genotype B

[Download (right click)] [Edit] [Sequences] [Repertoires]

2627 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JX429911_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLSFFLPSDFFPSIRDLLDTASALYQ
JX847951_HBe_P-B      SKLCLGWLWDMDIDPYKEFGATTPLLS-FLPADFFPSVRDLLDTANALYG
KU668369_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
AB900112_HBe_P-B      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPQDFYPSVRDLLDTASALYR
FJ386660_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB246343_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
FJ023573_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
FJ023605_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023606_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023607_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023609_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023610_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023611_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023612_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023613_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023614_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023617_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023618_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023620_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023628_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023629_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023630_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ667207_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775482_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775483_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023608_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166160_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
KF166273_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
D00329_HBe_P-B        SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTVSALYR
AY269108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRELLDTASAQYR
KP406273_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP659234_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073851_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFYPSVRDLLDTAAALYR
AB073850_HBe_P-B      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB010289_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073846_HBe_P-B      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073848_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB205121_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB246341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB246342_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB287314_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB287315_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659235_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659237_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659247_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279268_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279269_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279270_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279271_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279272_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279273_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LT992442_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GU815747_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
GU815748_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KU576691_HBe_P-B      SKLCLEWLWDMDIDPYKEFGASAELLS-FLPSDFFPNVRDLLDTASALYR
KU576754_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDPLDTASALYR
KP406260_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406262_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406266_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406280_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406257_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF480341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFIDTASALYR
EU306696_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570070_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341479_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689444_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYR
MK037633_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF568491_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPNIRDLLDTASALYR
AF480355_HBe_P-B      SKLCLGWLRGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AB908303_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038060_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDSFPSIRDLLDTASALYR
MG571361_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYQ
KU668216_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JQ341499_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASXELLS-FLPSDFYPSIRDLLDTASALYR
GU815619_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330997_HBe_P-B      SKLCLGWLRGMDIDPYKGFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993707_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040808_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVESLS-FLPSDLFPSIRDLLDTASALYR
MK038204_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRNLLDTASALYR
KF165332_HBe_P-B      SKLCLEWLWGMDIDPYKEFGASAELLS-FLPSDFFPTIRDLLDTASALYR
KF165326_HBe_P-B      SKLCLEWLWGMDIDPYKEFGASAELLS-FLPSDFFPTIRDLLDTASALYR
GU815700_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815640_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
GU815639_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GU815635_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032353_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073831_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
MZ675804_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675800_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MZ675798_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MT427108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELIA-FLPSDFFPSIRDLLDTASALYR
MT427097_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FFPSDFSLSIRDLLDTASALYR
MT427037_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426999_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426994_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040865_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
MK040809_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038449_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038435_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038291_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038284_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
MK038183_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038090_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
MK038046_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037960_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FSPSDFFPSIRDLLDTASALYR
MK037942_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037789_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037673_HBe_P-B      SKLCLGWLWGTDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037644_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037641_HBe_P-B      SKRCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037639_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037525_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571374_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470961_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASTLYR
KY470960_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASTLYR
KU668328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668289_HBe_P-B      SKLCLGWLWGMDIDPYKEFGTSVELLS-FLPSDFFPNIRDLLDTASALYR
KU667955_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667859_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU576189_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576041_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575977_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148433_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148410_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148407_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148392_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVESLS-FLPSDFFPPIRDLLDTASALYR
KP148382_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
KP148366_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148364_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRALLDTASALYR
KJ803796_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803795_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803781_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF166807_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164936_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPLDFFPSVRELLDTASALYR
KF164901_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPFDFFPSIRDLLDTASALYR
JX848240_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848154_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847950_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429897_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAPALYR
JQ341490_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038199_HBe_P-B      SKLCLGWLWGMDIGPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038187_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038184_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038182_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038172_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038109_HBe_P-B      SRLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674507_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674462_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674423_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674419_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674396_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
KX276805_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTXSALYR
KU668336_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667936_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667540_HBe_P-B      SELCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667493_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU576624_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYR
KP406294_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148345_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDIFPSIRDLLDTASALYR
KP148335_HBe_P-B      SKLCPGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ843165_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIQDLLDTASALYR
KJ173386_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KF166709_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165321_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KC774362_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
JX848048_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848041_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847933_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
JX661480_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
JX661479_HBe_P-B      SQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661477_HBe_P-B      LQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ429081_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AB100695_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
MK037554_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427043_HBe_P-B      SKLCLGCLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534732_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK534708_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK534705_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK534703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK040838_HBe_P-B      SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK040815_HBe_P-B      SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038452_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038431_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038357_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK038321_HBe_P-B      SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038319_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037622_HBe_P-B      PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674506_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MF674414_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FXPSDFFPSIRDLLDTASALYR
MF674392_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KY470954_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KU964107_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964105_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964104_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964102_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964101_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964100_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964098_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964096_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU668318_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTDSALYR
KU667980_HBe_P-B      YKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667956_HBe_P-B      SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667448_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYR
KU577004_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFLSIRDLLDTASALYR
KU576309_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KP148413_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166967_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF166311_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF165415_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KC774375_HBe_P-B      PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774369_HBe_P-B      PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX869998_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848211_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
JX661476_HBe_P-B      RKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341482_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104451_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
MZ675807_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675806_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675805_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675803_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675802_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675801_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MZ675799_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675797_HBe_P-B      SKLCLGWLSGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675796_HBe_P-B      SKLCLGWLSGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675795_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675794_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675786_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ675785_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ671239_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ671238_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MZ671236_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MW310264_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT645058_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT645057_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT645041_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT645025_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT448621_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427109_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-SLPSDFFPSIRDLLDTASALYR
MT427107_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427106_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427105_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427104_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-PLPSDFFPSIRDLLDTASALYR
MT427103_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427102_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427101_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427100_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
MT427099_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427098_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
MT427096_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427095_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427094_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427093_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427092_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427091_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427090_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427089_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427088_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427087_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427086_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427085_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427084_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427083_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427082_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427081_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427080_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427079_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-SLPSDFFPSIRDLLDTASALYR
MT427078_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427077_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427076_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427074_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427073_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427071_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427070_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427069_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427068_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427066_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427065_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427064_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427063_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427062_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427061_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427060_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427059_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427058_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427057_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427056_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427054_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427053_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427052_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427051_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427050_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427049_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427048_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427047_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427046_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427045_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427044_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427041_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427040_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427039_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427038_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427036_HBe_P-B      SKLCLGWLWGMDIDPHKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427035_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427034_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427033_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427032_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427031_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427030_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427029_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427028_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427027_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427026_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427025_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427024_HBe_P-B      SKLCLGWLCGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427023_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427022_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427021_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427020_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427019_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427018_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427017_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427016_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427015_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427014_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427013_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427012_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427011_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427010_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427009_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427008_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427007_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427006_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427005_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427004_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427002_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427001_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427000_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426998_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426997_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426996_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426995_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426993_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426992_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426991_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426990_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426989_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426987_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426986_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426985_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426984_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MT426983_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426982_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426981_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426979_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426978_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426977_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426975_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426974_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426973_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426972_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426971_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426969_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426968_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426967_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426966_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426965_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426963_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426961_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426960_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426958_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426957_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426956_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426955_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALNR
MT426954_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426953_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426951_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426950_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426949_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426948_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426947_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426946_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426945_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSNFFPSIRDLLDTASALYR
MT426944_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426943_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426942_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426941_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426940_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426938_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
MT426937_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426936_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426935_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426934_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426933_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426932_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426931_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426930_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426928_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426927_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426926_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426925_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426924_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426923_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426922_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426921_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426920_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426919_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426918_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426917_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426916_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426915_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426914_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
MT426913_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426912_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426911_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAAVELLS-FLPSDFFPSIRDLLDTASALYR
MT426910_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MT426909_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426908_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426907_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426906_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426905_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426904_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426903_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426902_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426901_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426899_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426898_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426897_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426896_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426895_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426894_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426893_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426892_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426891_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426890_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426889_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426888_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426887_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426886_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426885_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426884_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426883_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426882_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426881_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426880_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426879_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426877_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426876_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426875_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426874_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426873_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426872_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426871_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426870_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426869_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426868_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426867_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426866_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426865_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426864_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426863_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426862_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426861_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426860_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426859_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426104_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426100_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT111595_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689123_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689122_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689121_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689120_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534733_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534711_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534710_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534709_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534707_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534702_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534697_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534694_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534693_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534683_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534634_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534629_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534614_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534611_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534603_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534602_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534601_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534600_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534581_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534578_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534576_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534575_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534573_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534572_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534571_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534570_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534554_HBe_P-B      SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK075117_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052965_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040877_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040876_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040873_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040872_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040869_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040867_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040866_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040864_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040863_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040861_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLASDFFPSIRDLLDTASALYR
MK040860_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040857_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040856_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040855_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040854_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040852_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040849_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040848_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040847_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040846_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040845_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040844_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040790_HBe_P-B      SKLCLGWLEGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040778_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040777_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040776_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040770_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040769_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038488_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038486_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038481_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038480_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038479_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038478_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038474_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038473_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038470_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038468_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038465_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038463_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038460_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038458_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038457_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038456_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038453_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038451_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038450_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038447_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038446_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038445_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038440_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038439_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038437_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038433_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038432_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038429_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK038428_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK038360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038359_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038355_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038354_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038350_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038348_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038334_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038332_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038330_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038327_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038325_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038322_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038320_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038317_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038315_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038312_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038311_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038309_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038302_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038301_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
MK038300_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038296_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038295_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038294_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038292_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038286_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038280_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038279_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038278_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038277_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038272_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038269_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038267_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038266_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038265_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038264_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038256_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038255_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038250_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038248_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038247_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038246_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038245_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038244_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038242_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038241_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038240_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038239_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038238_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038237_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038234_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038233_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038232_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038231_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038230_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038229_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038227_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038226_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038225_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038224_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038223_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038222_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038221_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038220_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038219_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038218_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038217_HBe_P-B      SKLCLGWLWGMDIGPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038216_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038215_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038210_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038201_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038197_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038195_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK038194_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038193_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038192_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038191_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038190_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038189_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038186_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038185_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038181_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038179_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038178_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038177_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038174_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038173_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038171_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038168_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038165_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038164_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038161_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038160_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038157_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038155_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038153_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038151_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK038149_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038147_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038145_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038144_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038137_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038122_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038119_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038113_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038112_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038111_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
MK038108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038106_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038103_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038102_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038099_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038092_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038082_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038081_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038079_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038078_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038077_HBe_P-B      SKLCLGWLGGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038076_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038075_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038074_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038071_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038070_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038068_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038067_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038066_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038064_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038062_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038061_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038059_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038057_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038056_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038055_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038054_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038053_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038052_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038051_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038050_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038049_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038048_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038047_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038045_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038041_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038040_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038039_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038038_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038037_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFLDTASALYR
MK038036_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038035_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038031_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038030_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038027_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038026_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038012_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037997_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037991_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037972_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037963_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037957_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037952_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037951_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037950_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037948_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037945_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037940_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037936_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037930_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037925_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037914_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037909_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037902_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037880_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037877_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037867_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037835_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037834_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037831_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MK037830_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037828_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037827_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK037824_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MK037823_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037820_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037816_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037814_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037813_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037809_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037795_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037793_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037792_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037791_HBe_P-B      SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037790_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037787_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037786_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037785_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037784_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037782_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037650_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037649_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037648_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037647_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037643_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037640_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037638_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037637_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037624_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037621_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK037618_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037617_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037615_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037614_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037612_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037611_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037596_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037591_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037569_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037563_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037558_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK037556_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037553_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037534_HBe_P-B      SKLRLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037533_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037532_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037531_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037530_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037529_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037527_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037526_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037521_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037517_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH663473_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH061283_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826153_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571371_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571369_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571368_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571366_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571365_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571364_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571362_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571356_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571355_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571349_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571348_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571347_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571346_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571344_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571342_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571340_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571323_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571322_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674515_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674513_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674512_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674510_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674509_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674500_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674497_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674495_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674493_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674490_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674488_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674485_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674483_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674482_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674481_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674480_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
MF674479_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674477_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674476_HBe_P-B      SKLCLGWLWAMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674460_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674456_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674455_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674453_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674452_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674451_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674449_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674443_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674438_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674437_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674432_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674431_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674427_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674426_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674424_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674421_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674416_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674413_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674410_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674409_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF674405_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674404_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674400_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674397_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674395_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674394_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674393_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674387_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674384_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674383_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674382_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
M54923_HBe_P-B        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC349878_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC349873_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881779_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881778_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881761_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881760_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881759_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881757_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881756_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881753_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881752_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881747_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881746_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881745_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881741_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881740_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881735_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881734_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881733_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881732_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881731_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881730_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881729_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881728_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881727_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881726_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881725_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881724_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881723_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881722_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881721_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689563_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689553_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KY689546_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689538_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689517_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689480_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689477_HBe_P-B      SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689472_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689443_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689426_HBe_P-B      SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689413_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY629636_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470956_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470953_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765856_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276824_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964165_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964164_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964155_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KU963989_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963988_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963987_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963986_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963985_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963984_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963983_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963982_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963981_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963980_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963979_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963978_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963977_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963976_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963975_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963974_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963973_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963972_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963971_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963970_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963969_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963968_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963967_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963966_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963965_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963964_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963963_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963961_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963960_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963959_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963958_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963957_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963956_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963955_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963954_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963953_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963952_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963951_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963950_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963949_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963948_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963947_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963946_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963945_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963855_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963854_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963853_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963852_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963851_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963850_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963849_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963848_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963847_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963846_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963845_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963844_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963843_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963842_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963841_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963840_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963839_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963838_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963837_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963836_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963835_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963834_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963833_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963832_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963831_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963830_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963829_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963828_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963827_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963826_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963825_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963824_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963823_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963822_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963821_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963820_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963819_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963818_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963817_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963816_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963815_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963814_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963813_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963812_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963811_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963810_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963809_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963808_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963807_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963806_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963805_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963804_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963803_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963802_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963801_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963800_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963799_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668330_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668307_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668300_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668299_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668149_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668133_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668115_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668093_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSFRDLLDTASALYR
KU668076_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668069_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668061_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668046_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668037_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668009_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667996_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667879_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667840_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667784_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU667700_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667612_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU667569_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667515_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667508_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667484_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELHS-FLPSDFFPSIRDLLDTASALYR
KU667469_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667460_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667457_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667438_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667422_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667412_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELFS-FLPSDFFPNIRDLLDTASALYR
KU577089_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALCR
KU577081_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
KU576940_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576873_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576872_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576871_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576870_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576869_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576868_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576867_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576866_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576806_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576804_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576794_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576793_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576788_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576785_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576784_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576783_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576782_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576781_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576780_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576778_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576777_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576327_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576326_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576325_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576324_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576321_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576320_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU576319_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576310_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576052_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
KU576045_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576043_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576039_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576038_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576024_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576022_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU234318_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR232337_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR152339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406292_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406281_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243503_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243476_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243470_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243468_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243451_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243440_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243437_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243277_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243205_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148583_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148580_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148461_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148457_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148456_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148455_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148453_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148451_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148440_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148439_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148438_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148435_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148430_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148429_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148427_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148425_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148424_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148423_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148421_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYR
KP148420_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148419_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148418_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148414_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148411_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148409_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148406_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148405_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148403_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148402_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148401_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148400_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148398_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148397_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148396_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
KP148395_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148394_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148390_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148389_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148388_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148387_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148386_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148385_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148384_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148383_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148380_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148379_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148378_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148377_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148376_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148375_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148374_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148373_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148372_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148371_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148370_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148369_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148368_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148365_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148362_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148361_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148359_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148357_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148356_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148349_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148348_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148347_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148346_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148344_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148343_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148342_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148340_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148338_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148336_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148334_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148333_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148331_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148330_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148327_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148326_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148325_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148324_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148323_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148322_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148321_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148320_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148319_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148318_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148317_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392084_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392083_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392072_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM359440_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803817_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803797_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
KJ803787_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KJ803784_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803783_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803764_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803763_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410517_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410516_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410507_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410490_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173425_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173424_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173423_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173422_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173421_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173420_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173417_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173416_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173415_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173414_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173413_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173412_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173411_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173410_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173409_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173408_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173407_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173406_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173405_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173404_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173403_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173402_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173401_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173400_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173399_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173398_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173397_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173390_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173389_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173388_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173387_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173382_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173381_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173379_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
KJ173376_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173375_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173374_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173370_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173369_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173367_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173366_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173365_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173364_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173361_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173359_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173357_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173356_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173355_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173354_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173353_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173352_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173351_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173347_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173345_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173343_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173342_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173340_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173297_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019238_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019236_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019233_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019232_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019231_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167174_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167158_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167092_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167079_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167051_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167028_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167001_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF166796_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166786_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166758_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166390_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166250_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165903_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165664_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165561_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165516_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165497_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165492_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165411_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165341_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165299_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165136_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165107_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165079_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165045_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF164905_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164875_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164853_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164852_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885519_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885462_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885426_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885369_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885345_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885331_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885327_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885326_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885317_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885308_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885305_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885175_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885120_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885110_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836874_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836865_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836864_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836863_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836861_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836857_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836853_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836843_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836841_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836830_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774418_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774416_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774413_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774411_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774409_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774408_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KC774404_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774403_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774401_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774399_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774398_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774394_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774393_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774392_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774390_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774388_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774387_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774386_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774384_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774382_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774381_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774380_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774378_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774376_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774374_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774372_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774370_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774368_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774366_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510660_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510659_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510658_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510657_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510656_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510655_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510654_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510653_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510652_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510651_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510650_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510649_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510648_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510647_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510646_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510643_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510642_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510641_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX978431_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX869999_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848311_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848310_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848244_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
JX848216_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848201_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848174_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848158_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848113_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848103_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848101_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLXDTASALYR
JX848093_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848092_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848049_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848030_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848020_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847997_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847994_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847965_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847959_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847958_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847956_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847952_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847943_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847938_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847910_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847896_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847895_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847894_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847893_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847890_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847889_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661484_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661483_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661482_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661481_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661478_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661475_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661474_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661473_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661472_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661471_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661470_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX507215_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX507210_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
JX429908_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429902_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429899_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX079938_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801514_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801512_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801507_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801479_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801471_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ688405_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341530_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341510_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341496_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341486_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDSASALYR
JQ341485_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341484_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341481_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341477_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341470_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341465_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341464_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341489_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689485_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689414_HBe_P-B      SKLCLGWLXXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689408_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848075_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848038_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX847885_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341502_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341483_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341467_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALXR
JX848263_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ341463_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSXXDLLDTASALYR
JQ341504_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562296_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYR
JQ341491_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
JX848179_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
KU576856_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576623_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYG
KU576240_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576619_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576620_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576629_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576630_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576633_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576640_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576641_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576645_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576647_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLNTASALYR
KU576656_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576681_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576692_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-LLPTDFFPSIRDLLDTASALYR
KU576693_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576698_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576704_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576714_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576738_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576748_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576751_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576766_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576843_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576845_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576848_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576854_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576874_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
GU815701_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF494380_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815552_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815564_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815669_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534727_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
AB493833_HBe_P-B      SNLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334299_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334300_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334301_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334302_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334303_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB355454_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU487256_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038448_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144550_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFSPSIRDLLDTASALYR
MK038461_HBe_P-B      FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038298_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038209_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038180_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037794_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426980_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426878_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038454_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038293_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038063_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038058_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037971_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037869_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037675_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037672_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037528_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037512_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276821_HBe_P-B      SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFXPSIRDLLDTASALXR
KY689557_HBe_P-B      SKLCLGWLWGMDIDPYKXFGASVELLS-FLPSDFFPSIRDLLDTASALXR
FJ562311_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF164957_HBe_P-B      SKLCLEWLWDMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
KU964381_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964382_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964383_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964384_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964385_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964388_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964391_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964393_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964395_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964397_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964386_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964387_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964389_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964390_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964392_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964396_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689469_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPNDFFPNIRDLLDTAAALHR
KY689516_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPNDFFPNIRDLLDTAAALHR
KU668003_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRNLLDTANALYR
KU576069_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU576070_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
FJ386648_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASLELLS-FLPSDFFPSIRDLLDTAAALYR
AJ298864_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MG826152_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTTAALYR
HM011474_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY269102_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
KX012624_HBe_P-B      SKLCLGWLWDMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB713530_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB231909_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
AB908300_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY596110_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406264_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406255_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406263_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406265_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406268_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406270_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406272_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406278_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406279_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLA-FLPSDFFPSIRDLLDTATALYR
KP406261_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU668309_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRNLLDTANALYR
KU667987_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU576702_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU576707_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU576718_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU667997_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU668332_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
KU576713_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALYR
X98077_HBe_P-B        SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPAVRDLLDTASALYR
KF165461_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
KF165545_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
GQ924635_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALYR
EF473973_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDSFPSIRDLLDTASALYR
DQ993687_HBe_P-B      SKLCLGWLWGMDIDPYKEFGSSAELLS-FLPSDFFPSIRDLLDTASALYR
AY596111_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
AF480364_HBe_P-B      SKLCLGWLWGMDIDPYIEFRASGELLS-FLPSDFFPSIRDLLDTASALYR
AF282917_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
AF282918_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
X97851_HBe_P-B        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480337_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
AF480344_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
AF480356_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
HM011487_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATTELVS-FLPSDFFPSIRDLLDTASALYR
GQ377644_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF436921_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY382514_HBe_P-B      SKLCLGWLWGMAIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB713532_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855559_HBe_P-B      SKLCLGWFWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTVSALYR
JX848236_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104470_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
AB900110_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYR
FJ562224_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562253_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386688_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
AY269105_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB212626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AY220703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AY220704_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
EU939639_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
FJ562257_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB241116_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
AB241117_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
AY269128_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU660224_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU881998_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU882004_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032349_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386675_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562289_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ751769_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377519_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY167098_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYR
EU939633_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939634_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576299_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576308_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924638_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALFR
AB073825_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
DQ361535_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF494381_HBe_P-B      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MK038341_HBe_P-B      SKLCLGWLWGMDIDPYKKFGASVELLS-FLPSDFFPSIRDLLDTASTLYR
MK038268_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276809_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPNDFFPSMRDLLDTASALYR
KU668173_HBe_P-B      SKLCLGWLWGMDIDPYKESGASVELLS-FLSPDFFPSIRDLLDTASALYR
KU667858_HBe_P-B      SKLCLGWLWGMDIDPYKESGAPVELLS-FLPSDFSPSIRDLLDTASALYR
KU576637_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDAASALYR
KU576303_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576300_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406163_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KF166717_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
JX848132_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIPDLLDTASALYR
JX848124_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GU815587_HBe_P-B      SKLCLGWLWGMDIDPYEEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855526_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
GQ358147_HBe_P-B      SKLCLGWIWGMDIDPYKEFGASVEVLS-FLPSDSFPSIRDLLDTASALYR
GQ358145_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVEVLS-FLPSDFFPSIRDLLDTASALYR
FJ032357_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
FJ032358_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
EU939669_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
FJ899779_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
EU939559_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF494382_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPNIRDLLDTANALYR
EF134946_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341462_HBe_P-B      SKLCLGWLWGMDIDPYKEFXASVELLS-FLPSDFFPSIRDLLDTASALYR
EF134945_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ904357_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144561_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144598_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480361_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480351_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480350_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480353_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480349_HBe_P-B      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
GU815657_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480346_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480359_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480363_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480343_HBe_P-B      SKLCLGWLWGMDIDLYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480340_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480347_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480352_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480354_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480358_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF335754_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023575_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF335748_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
AB908299_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023633_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB713531_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
FJ023636_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
AB713528_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
JQ027316_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB219426_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AF480348_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AB212625_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASAELLS-FLPSDFFPTIRDLLDTATALYR
AB073833_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB246340_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AY269110_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYR
AB073821_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480338_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480345_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480357_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AF480362_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AB355453_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF480342_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
D00330_HBe_P-B        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MT757454_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPPDFFPSIRDLLDTATALYR
MK037669_HBe_P-B      SKLCLGWLWGMDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571327_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KY881850_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX276806_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYR
KU668012_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDIASALYR
KU667640_HBe_P-B      SKQCLGRLWGMDIDPYKEFGASVELLS-FLSSDFFPSIRDLLDTASALYR
KP406175_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406172_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406170_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406168_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
KF166875_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYR
KF166549_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
JX848265_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
JX848149_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
JX848136_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
JX848024_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
GU815754_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815712_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358144_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386676_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ386600_HBe_P-B      SKLCLGWLWGMDIDTYKENGASVELLS-FLPSDFFPSIRDLLDTASALHR
EU439020_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVEVLS-FLPSDFFPSIRDLLDTASALYR
EU306703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF473974_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLHTASALNR
AM888201_HBe_P-B      SKLCLGWLWGMDIDPYKEFGPSVELLS-FLPSDFFPSIRDLLDTASALYR
AB033554_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073822_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
AF157023_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF335738_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
EU796066_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040760_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038326_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038188_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038123_HBe_P-B      SKPCLGWLRGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037910_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYQ
KU576306_HBe_P-B      SKLCLGWLWGMDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575966_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707744_HBe_P-B      STLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
AB493827_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRXLLNPVLVLYR
AB033555_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB048705_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073826_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073827_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073828_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073829_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073834_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB073840_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALDR
AB115551_HBe_P-B      SKLCLGWLWAMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195933_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195934_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195935_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB205119_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB219428_HBe_C-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB219429_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB219430_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB246339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB287328_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB287329_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB300364_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB355455_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471854_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471855_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB675676_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB713527_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB908304_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF100308_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121243_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121244_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121245_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121246_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121247_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF121249_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF157020_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF157024_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF233235_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF233237_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF335740_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF335741_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF335746_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040775_HBe_P-B      SKLCLGWLWGMDIDPCKEFGASMELLS-FLPSDFFPSIRDLLDSASALYR
KX276830_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
KU576600_HBe_P-B      SKLCLGWLWGMDIDAYKEFGASVELLS-FLPSDFFPSIRELLDTASALYR
KU576322_HBe_P-B      SELCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576302_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
KU576132_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KU576088_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAFVELLS-FLPSDFFPSIRDLLDTASALYR
KU575981_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVVLLS-FLPTDFFPSIRDLLDTASALYR
KP406334_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406333_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406332_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406330_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148332_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KF166964_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
KF166890_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
KF166801_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
KC774419_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JX848250_HBe_P-B      SKLCLGWLWGIDIDTYKEFGASVDLLS-FLPSDFFPSVRDLLDTASALHR
JX847987_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTPSALYR
GU827630_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815751_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
GU815558_HBe_P-B      SKLCLGWLWGVDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
GU815554_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU919171_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330996_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448623_HBe_P-B      CKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269109_HBe_P-B      SKLCLGWLWGMDIDPYKEFRASVELLS-FLPSDFFPSIRDLLDTASALYR
AF100309_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493835_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDAASALYR
GQ924610_HBe_P-B      SKLCLGWLWGMDIDRYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386636_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040169_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JQ341473_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040128_HBe_P-B      SKLCLGWLWGMDIDTYXEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT757457_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757456_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757455_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757453_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757452_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLGTATALYR
MT757451_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757449_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757448_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757447_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757446_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757445_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757444_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757443_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757442_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757441_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757440_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757439_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757438_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MT757436_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MK040768_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038203_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038141_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDSASALYR
MK037505_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571351_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF621878_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTATALYR
LC349872_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881795_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881783_HBe_P-B      SKLCLGWLWGMDIDKYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689507_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689506_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689505_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689410_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470840_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470838_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470835_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470833_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470832_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470830_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964158_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU668027_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU577107_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576970_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KU576877_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
KU576809_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPPDFFPSIRDLLDTASALHR
KU576807_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPPDFFPSIRDLLDTVSALHR
KU576460_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU576304_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576051_HBe_P-B      SKLCLGWLWGMDIDTYKAFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576046_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406335_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406267_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KP406174_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406169_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167139_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167006_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KF166828_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166763_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KF166702_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF166065_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KF165526_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165353_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164967_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KF164962_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
KF164931_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
JX848279_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
JX848269_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX847899_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847886_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPNVRDLLDTAAALYR
JX507213_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALXR
JQ707767_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707765_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707764_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707763_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707759_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707758_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707755_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707750_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707749_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707747_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707743_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707742_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707739_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707738_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707737_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ707734_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JQ341497_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341461_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341459_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040173_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040171_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040170_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040125_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827419_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN406371_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104478_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104474_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104472_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104469_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104468_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104467_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104466_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104460_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104458_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104453_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104452_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104450_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104449_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104448_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104447_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104446_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF899335_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775484_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775480_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF412801_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700549_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700548_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700546_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
HM011504_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815780_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815771_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815770_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815769_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815768_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815767_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815766_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815765_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815764_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815762_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815761_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815760_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815759_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815756_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815755_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815753_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815752_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815750_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815749_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815746_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815745_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815744_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815743_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815742_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815741_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815740_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815739_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815738_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815737_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815736_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815735_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815734_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815733_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815732_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815731_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815730_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815729_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815728_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815727_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815726_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815725_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815724_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815723_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815722_HBe_P-B      SKLCLGWLWGMGIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815721_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815720_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815719_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815718_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815717_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815716_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815715_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815713_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815711_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815709_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815708_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815705_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815704_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815702_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815698_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815697_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815696_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815695_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815694_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815693_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815692_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815691_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815689_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815688_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815687_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815686_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815685_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815684_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815683_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815681_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815680_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815679_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815678_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815677_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815676_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815675_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815674_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815673_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815672_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815670_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815668_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815667_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815666_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815665_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815664_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815663_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815662_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815661_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815660_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815659_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
GU815658_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815656_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815654_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815653_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815652_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815651_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815650_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815649_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815648_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815647_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815646_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815645_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815644_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815643_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815642_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815638_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815637_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815636_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815634_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815633_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815632_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815631_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815628_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVDLLS-FLPSDFFPSIRDLLDTASALYR
GU815626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815625_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815624_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815623_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815622_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815621_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815620_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815618_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815617_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815616_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815614_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815613_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815612_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDPLDTASALYR
GU815611_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815610_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815608_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815607_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815606_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815605_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815604_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815603_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815602_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815601_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815600_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815599_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815598_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815597_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815596_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815595_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815593_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815590_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815588_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815586_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815585_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815584_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815581_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815579_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815577_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815576_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815575_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815574_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815573_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815572_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815571_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815570_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815569_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815568_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815567_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815566_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815565_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815563_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815562_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815561_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815560_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815559_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815557_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815556_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815555_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815553_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815551_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815550_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815549_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815548_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU451682_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU434373_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU434372_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU357842_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924654_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924653_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924651_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924640_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924634_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924631_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924624_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
GQ924621_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924611_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924608_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924607_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924606_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASXLYR
GQ924605_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924603_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855555_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855532_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855522_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475340_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ377643_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377641_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377639_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377638_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377629_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377625_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377612_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377588_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377587_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377569_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377568_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377566_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377561_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377558_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377542_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377537_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377525_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
GQ358152_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358151_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358150_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358149_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358148_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358143_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358142_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358141_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358138_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358137_HBe_P-B      SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358136_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787444_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ755833_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ751767_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562322_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ518812_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386684_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386668_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386666_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386655_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386654_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386642_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386584_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386583_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386582_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ349236_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032354_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032352_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFLPSIRDLLDTASALYR
FJ023638_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023637_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023635_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023634_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023576_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023569_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939676_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
EU841393_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU796071_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU796068_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU796067_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570071_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570069_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU439023_HBe_P-B      SKLRLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU439022_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU439021_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU439018_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU350409_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU331001_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU331000_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330999_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330998_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330994_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330992_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330990_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330989_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306712_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTTSALYR
EU306710_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306709_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306708_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306707_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306706_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306705_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306704_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306702_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306701_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306700_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306699_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFLDTASALYR
EU306698_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306697_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306695_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306677_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU305548_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU305547_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU139543_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF473977_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF473976_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF473975_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF473972_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ995805_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDPLDTASALYR
DQ995801_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993711_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993709_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993708_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIPDLLDTASALYR
DQ993706_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993703_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993701_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993700_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993697_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993696_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993694_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ975271_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448628_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448627_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448626_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448625_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448624_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448622_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448621_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448620_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ448619_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144599_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144597_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
DQ144594_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144564_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144560_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
D00331_HBe_C-B        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY766463_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY596102_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY518556_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY293309_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269135_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269131_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269120_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269115_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269100_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269097_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269095_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFSPSIRDLLDTASALYR
AY269093_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269091_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY220698_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY217360_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY217359_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY167089_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY033073_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY033072_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011096_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011095_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011092_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011091_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011090_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011089_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011088_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011087_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011086_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011085_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011084_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427072_HBe_P-B      SKLCLGWLWGIDIDPYKEFGASVELLS-SFPSDFFPSIRDLLDTASALYR
MT427067_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427055_HBe_P-B      SKLCLGWLWGMDIDPYKECGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426964_HBe_P-B      SKLCLGWLWGMDIDPYKESGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426900_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYL
MK040749_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYQ
MK040742_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQ
MK040740_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQ
MK038485_HBe_P-B      SKLCLGWLWGMDIDPYKELGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038212_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQ
MK038073_HBe_P-B      SKLCLGWRWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037911_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQ
MK037885_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
MK037783_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037776_HBe_P-B      SKLCLGWLWGMDIDPYKEFGAAVELLS-FLPSDFFPSIRDLLDTASALYR
MK037570_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674407_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674385_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQ
MF568485_HBe_P-B      SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KY881906_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881848_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881799_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FFPSDFFPSIRDLLDTASALYR
KY881798_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689523_HBe_P-B      SXLXLGWLWGMDIDXYKEFGFSVELLS-FLPSDFFPSIRDLLDTASALYR
KY689433_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
KU679959_HBe_P-B      SKQCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYR
KU668308_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU577003_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576746_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576307_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576295_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576288_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
KU575973_HBe_P-B      PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406173_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406171_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148582_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173373_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166809_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYQ
KF166765_HBe_P-B      SELCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165857_HBe_P-B      SKLCLGWLWGMDIDPYKEIGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774406_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848104_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLHTASALYR
JQ341475_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341460_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF479684_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASVLYR
KX276774_HBe_P-B      SKLCLEWLWDMDIDPYKEFGASVELLS-FLPXDFFPSIRDLLDTASALYR
MG571321_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427003_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426959_HBe_P-B      SKLCLGWLWGMDIDPYNEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426929_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
MK040871_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040870_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040868_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040859_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040858_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLPDTASALYR
MK040850_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038469_HBe_P-B      SKLCLGWLWGTDIDPYKEFGASVELLS-FLPSDFFPSIRNLLDTASALYR
MK038347_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038314_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLHDTASALYR
MK038313_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDAASALYR
MK038146_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038132_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDSASALYR
MK038044_HBe_P-B      SKLCLGWLWGMDIDPYREFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038043_HBe_P-B      SKLCLGWLWGMDIDPYREFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037946_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLFDTASALYR
MK037613_HBe_P-B      SKLRLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037518_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037510_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571331_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
MF674401_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689564_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689448_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATAMYR
KX276776_HBe_P-B      SKLCLGWLXDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KU668358_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668124_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668116_HBe_P-B      SKLCLGWLWGMDIGPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668108_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668058_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576042_HBe_P-B      SKLCLGWLWGMDIDPYREFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576026_HBe_P-B      SKLCLGWLWGMDIDPYEEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576018_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576015_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575984_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575983_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575982_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575980_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575979_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575978_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575976_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575974_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575959_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575945_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575928_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575927_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575922_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406162_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148579_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDAASALYR
KP148391_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173348_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019221_HBe_P-B      SKLCLGWLWGMDIDPYLEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167120_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166996_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885550_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836872_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KC774396_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
JX848207_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPAIRDLLDTATALYR
FJ386610_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
MZ671237_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MW310263_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MW310262_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MW310261_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427075_HBe_P-B      SKLCLGWLWGMDIDRYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK534696_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052964_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040832_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040763_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040755_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040754_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040753_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038462_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038368_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038356_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038353_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MK038345_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038342_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038339_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
MK038331_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038258_HBe_P-B      SKLCLGWLWGMDVDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038162_HBe_P-B      SKLCLGWLWGVDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038080_HBe_P-B      SKLCLGWLWGMDVDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038042_HBe_P-B      SKLCLGWLWGTDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038000_HBe_P-B      SKLCLGWLWGMDIGTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037985_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037982_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037981_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK037976_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037974_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037969_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037968_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037964_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037962_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037959_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037956_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK037955_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037953_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037944_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK037943_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK037941_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037917_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037913_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
MK037912_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037907_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037901_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037868_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037866_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037765_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037761_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037519_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037509_HBe_P-B      SKLCLGWLWGMDIVTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571334_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674487_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674469_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674420_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674391_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674389_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
LC416037_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
LC349877_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881861_HBe_P-B      SKLCLGWLLGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881808_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881801_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881800_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881797_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KY881796_HBe_P-B      SKLCLGWLWGMDTDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881794_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881793_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881791_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881790_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881789_HBe_P-B      SKLCLGWLWGTDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881788_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881787_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881786_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881784_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881782_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881781_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881780_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689562_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY689419_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY629635_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470841_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470837_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470834_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964168_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964167_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964166_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964163_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964162_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964161_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964160_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964159_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964157_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964156_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964154_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KU964153_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964106_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964103_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964099_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964097_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964095_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964094_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964093_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964092_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964091_HBe_P-B      SKLCLGWLWGMDIDTYKEFGAYVELLS-FLPSDFFPSIRDLLETATALYR
KU964090_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964089_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964088_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964087_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964085_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964084_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964083_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964081_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU964079_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KU667659_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLSSDFFPSIRDLLDTASALYR
KU667647_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667590_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576969_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576968_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576879_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576875_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576808_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576803_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576331_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576297_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576054_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576053_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148581_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148452_HBe_P-B      SKLCLGWLWGMDTDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP036970_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KM875426_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KM213034_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803752_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ173419_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ173418_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ173298_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167153_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KF167148_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF167122_HBe_P-B      SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167044_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166930_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166896_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166797_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166757_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
KF166749_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALHR
KF166660_HBe_P-B      SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166651_HBe_P-B      SKLCLGWLWGMDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166533_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166340_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166309_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166131_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166055_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165906_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165674_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165662_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KF165524_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KF165513_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KF165395_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165392_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165377_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165327_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165320_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KF165031_HBe_P-B      SKLCLGWLWGMDIDTYKAFGASVELLS-FLPSDFFPSVRDLLDTASALHR
KF164960_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164865_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYR
JX848300_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASMELLS-FLPSDFFPSVRDLLDTGSALYR
JX848232_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848028_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848003_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
JX847991_HBe_P-B      SKLCLGWLXXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTXXALYR
JX847972_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847903_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847891_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPFDFFPSIRDLLDTASALHR
JX847888_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX504538_HBe_P-B      SKLCLGWLWGMDTDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429910_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JQ341493_HBe_P-B      SKLCLGWLWGMDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939666_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575921_HBe_P-B      SKLCLGWLWGMDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243317_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYR
KF166382_HBe_P-B      SKLCLGWLWDMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYR
JX848291_HBe_P-B      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040157_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTXXALYR
KY689534_HBe_P-B      SKLCLGWLXXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATAMYR
JX848227_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX848218_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848203_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTAXALXR
HM011494_HBe_P-B      SKLCLGWLWGMDIDTYKEFGASVELLS-FLPSDFFPSXRDLLDTAXALYR
KY689520_HBe_P-B      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAXALYR
KY689488_HBe_P-B      SKLCLGWLWGMDIDTYKPFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KX276817_HBe_P-B      SKLCLGWLXXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243260_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848245_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX848202_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX848195_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX848178_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848177_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848175_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848039_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847998_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847982_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341515_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341494_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341468_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JX848287_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSXRDLLDTASALHR
JX848114_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848089_HBe_P-B      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848318_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX848271_HBe_P-B      SKLCLGWLWGMDIDXYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JX848233_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSXRDLLDTAXALYR
JX848292_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSVRDLLDTAXALYR
KX276777_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848312_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX848241_HBe_P-B      SKLCLGWLXGMDIDTYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JX848196_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848165_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX848137_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JQ341487_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848185_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848267_HBe_P-B      SKLCLGWLXGMDIDXYKEFGASVELLS-FLPSDFFPXIRDLLDTASALYR
                                                .   .                   

JX429911_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847951_HBe_P-B      EALESPEHCSYHHTAIRQAILCWGELMNLATWVGSNLDDQASRELVVGYV
KU668369_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLKDPASRELVVGYV
AB900112_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYV
FJ386660_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYV
AB246343_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYV
FJ023573_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023605_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023606_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023607_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023609_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023610_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASGDLVVSYV
FJ023611_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023612_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023613_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023614_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023617_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023618_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023620_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023626_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023627_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023628_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023629_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023630_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ667207_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
JF775482_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
JF775483_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
FJ023608_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYV
KF166160_HBe_P-B      EALESPEHCSPHHTALRQAILCWDEVMNLATWVGSNLEDPASRDLVVGYV
KF166273_HBe_P-B      EALESPEHCSPHHTALRQAILCWDEVMNLATWVGSNLEDPASRDLVVGYV
D00329_HBe_P-B        EALKSPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AY269108_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KP406273_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYV
KP659234_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLKDPASRDLVVNYV
AB073851_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYV
AB073850_HBe_P-B      EALESPVHCSPHHTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYV
AB010289_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB073846_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB073848_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB205121_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB246341_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB246342_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB287314_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
AB287315_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
KP659235_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
KP659237_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
KP659247_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279268_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279269_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279270_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279271_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279272_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LC279273_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
LT992442_HBe_P-B      EALESPEHCSPHHXALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYV
GU815747_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815748_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576691_HBe_P-B      EALESPEHCSPHYTALRQAILCWGDLMNLATWVGSNLEDQASRDLVVSYV
KU576754_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMSLATWEGSNLEDPASRELVVSYV
KU576626_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KP406260_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYV
KP406262_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYV
KP406266_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYV
KP406280_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYV
KP406257_HBe_P-B      EALESPEHCSPHHTAIRQAILCWVELMNLATWVGSNLDDQASRELVVSYV
AF480341_HBe_P-B      EALESSEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EU306696_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYV
EU570070_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYV
JQ341479_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYV
KY689444_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYV
MK037633_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPAFRDLVVSYV
MF568491_HBe_P-B      EALESPEHCSPHHTALRQAILCRGELMNLATWVGSNLEDPASRELVVSYV
AF480355_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB908303_HBe_P-B      EALESLEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038060_HBe_P-B      EALESPERCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571361_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668216_HBe_P-B      EALESPEHCSPYHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYV
JQ341499_HBe_P-B      EALESPEHXTPHHTALRQAILCWGELMNLATWVGSNLEDPXSREXVVSYV
GU815619_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EU330997_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
DQ993707_HBe_P-B      EALEAPEHCSPHHTALRQALLCWGELMNLATWVGSNLEDPASRELVVSYV
MK040808_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK038204_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165332_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPASREVVVSYV
KF165326_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLDDPASREVVVSYV
GU815700_HBe_P-B      EALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815640_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815639_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
GU815635_HBe_P-B      EALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYV
FJ032353_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVSYV
AB073831_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675804_HBe_P-B      EALESPEHCSPHHTAPRQAILCWGELMNLATWVGSNLEDPASSELVVSYV
MZ675800_HBe_P-B      EALESPEHCSPHHTAPRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675798_HBe_P-B      EALESPEHCSPHHTAPRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427108_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427097_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427037_HBe_P-B      EALESPEQCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426999_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDRASRELVVSYV
MT426994_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDRASRELVVSYV
MK040865_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040809_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYV
MK038449_HBe_P-B      EALESPEHCSPHHAALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038435_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVSYV
MK038291_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038284_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038183_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLVDPASRELVVSYV
MK038090_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038046_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037960_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037942_HBe_P-B      EALESPEHCSPHHTAFRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037789_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATRVGSNLEDPASRELVVSYV
MK037673_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK037644_HBe_P-B      EALESPEHCSPRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037641_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037639_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037525_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVRSNLEDPASRELVVSYV
MG571374_HBe_P-B      EALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYV
KY470961_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY470960_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVSYV
KU668289_HBe_P-B      EASESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667955_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSSLEDPASRELVVSCV
KU667859_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576189_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYV
KU576041_HBe_P-B      EALESPEHCPPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU575977_HBe_P-B      EALESPERCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148433_HBe_P-B      EALESPEHCPPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148410_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELAVSYV
KP148407_HBe_P-B      EALESPEHCPPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148392_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148382_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148366_HBe_P-B      EALESPEHCSPYHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148364_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYV
KJ803796_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803795_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803781_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KF166807_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYV
KF164936_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF164901_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
JX848240_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848154_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847950_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX429897_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341490_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038199_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038187_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038184_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038182_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038172_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038109_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674507_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674462_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674423_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674419_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674396_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
KX276805_HBe_P-B      EALESPEHCSHHHTALRQAVLCWGELMNLATWVGSNLEDPASREAVVSYV
KU668336_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYV
KU667936_HBe_P-B      EALEPPEHCSPHHTALRQAILCWGELMKLATWVGSNLEDPASRELVVSYV
KU667540_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667493_HBe_P-B      EALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYV
KU576624_HBe_P-B      DALESPEHCSPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYV
KP406294_HBe_P-B      EALESPEHCSPHHTALRQANLCWGELMNLATWVGSNLEDPASRELVVSYV
KP148345_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLAAWVGSNLEDPASRELVVSYV
KP148335_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ843165_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173386_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166709_HBe_P-B      EALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPASRELVVSYV
KF165321_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774362_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848048_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
JX848041_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
JX847933_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661480_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661479_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661477_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ429081_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB100695_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHV
MK037554_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427043_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534732_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534708_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534705_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534703_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040838_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK040815_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK038452_HBe_P-B      EALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYV
MK038431_HBe_P-B      EALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYV
MK038357_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038321_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038319_HBe_P-B      EALESPEHCSPHHTALRQAILCWGEFMNLATWVGSNLEDPASRELVVSYV
MK037622_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674506_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674414_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674392_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY470954_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964107_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964105_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964104_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964102_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964101_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KU964100_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964098_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964096_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668318_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667980_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667956_HBe_P-B      GALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667448_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU577004_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576309_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148413_HBe_P-B      EALESPEHCSPHHTALRQAILRWDELMNLATWVGSNLEDPASRELVVSYV
KF166967_HBe_P-B      EALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166311_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165415_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774375_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774369_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX869998_HBe_P-B      EALESPEHCSPHHTALRQAILCWGEFMNLATWVGSNLEDPASRELVVSYV
JX848211_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661476_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341482_HBe_P-B      EALXSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JN104451_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675807_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675806_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675805_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675803_HBe_P-B      EALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675802_HBe_P-B      EALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675801_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675799_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675797_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675796_HBe_P-B      EALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675795_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASSELVVSYV
MZ675794_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675786_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MZ675785_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ671239_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ671238_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MZ671236_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MW310264_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT645058_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT645057_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT645041_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT645025_HBe_P-B      EALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYV
MT448621_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427109_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427107_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427106_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427105_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427104_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427103_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427102_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427101_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427100_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427099_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427098_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427096_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427095_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427094_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427093_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427092_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427091_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427090_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427089_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427088_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427087_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427086_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427085_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427084_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427083_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427082_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427081_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427080_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427079_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427078_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427077_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427076_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427074_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427073_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427071_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427070_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427069_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427068_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427066_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427065_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427064_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427063_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427062_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427061_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427060_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427059_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427058_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427057_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427056_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427054_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427053_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427052_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427051_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427050_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427049_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427048_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427047_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427046_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427045_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427044_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427041_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427040_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427039_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427038_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427036_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427035_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427034_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427033_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427032_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427031_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427030_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427029_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427028_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427027_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427026_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427025_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427024_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427023_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427022_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427021_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427020_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427019_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427018_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427017_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427016_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427015_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427014_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427013_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427012_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427011_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427010_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427009_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427008_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427007_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427006_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427005_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427004_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427002_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427001_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT427000_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426998_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426997_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426996_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426995_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426993_HBe_P-B      EAVESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426992_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426991_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426990_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426989_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426987_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426986_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426985_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426984_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426983_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426982_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426981_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426979_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426978_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426977_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426975_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426974_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426973_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426972_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426971_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426969_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426968_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426967_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426966_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426965_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426963_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426962_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426961_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426960_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426958_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426957_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426956_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426955_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426954_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426953_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426951_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426950_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426949_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426948_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426947_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426946_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426945_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426944_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426943_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426942_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426941_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426940_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426938_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426937_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426936_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426935_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426934_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426933_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426932_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426931_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426930_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426928_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426927_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426926_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426925_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426924_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426923_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426922_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426921_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426920_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426919_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426918_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426917_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426916_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426915_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426914_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426913_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426912_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426911_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426910_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426909_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426908_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426907_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426906_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426905_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426904_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426903_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426902_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426901_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426899_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426898_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426897_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426896_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426895_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426894_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426893_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426892_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426891_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426890_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426889_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426888_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426887_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426886_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426885_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426884_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426883_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426882_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426881_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426880_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426879_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426877_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426876_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426875_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426874_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426873_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426872_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426871_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426870_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426869_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426868_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426867_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426866_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426865_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426864_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426863_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426862_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426861_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426860_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426859_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426104_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT426100_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYV
MT111595_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MN689123_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MN689122_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MN689121_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MN689120_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534733_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534711_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534710_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534709_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534707_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534702_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534697_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534694_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK534693_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534683_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534634_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534629_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534627_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534626_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534614_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534611_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534603_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534602_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534601_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534600_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534581_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534578_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534576_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534575_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534573_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534572_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534571_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534570_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK534554_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK075117_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK052965_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK052962_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040877_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040876_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040873_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040872_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040869_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040867_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040866_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040864_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040863_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040861_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040860_HBe_P-B      EALESPGHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040857_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040856_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040855_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040854_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040852_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040849_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040848_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040847_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040846_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040845_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040844_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK040790_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040778_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040777_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040776_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040770_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK040769_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038488_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038486_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038481_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038480_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038479_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038478_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSHV
MK038474_HBe_P-B      EASESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
MK038473_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038470_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038468_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038465_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASGELVVSYV
MK038463_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038460_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVASYV
MK038458_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038457_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038456_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038453_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038451_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038450_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038447_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038446_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038445_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038440_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038439_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038437_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038433_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038432_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038429_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038428_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038360_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038359_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038355_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038354_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038350_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038348_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038334_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK038332_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038330_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038327_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038325_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038322_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038320_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038317_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038315_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038312_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038311_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038309_HBe_P-B      EAIESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038302_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038301_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038300_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038296_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038295_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELTNLATWVGSNLEDPASRELVVSYV
MK038294_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038292_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038286_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038280_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038279_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038278_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038277_HBe_P-B      EALESPEHCSPHHTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038272_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038269_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038267_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038266_HBe_P-B      EALESPEHCSPHHTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038265_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038264_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038256_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038255_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038250_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038248_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038247_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038246_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038245_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038244_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038242_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038241_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038240_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038239_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038238_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038237_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038234_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038233_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038232_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038231_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038230_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYV
MK038229_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038227_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038226_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038225_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038224_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038223_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASGELVVSYV
MK038222_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038221_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038220_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038219_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038218_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038217_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038216_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038215_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038210_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038201_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038197_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038195_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038194_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038193_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038192_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038191_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038190_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038189_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038186_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038185_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038181_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038179_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038178_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038177_HBe_P-B      EALEPPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038174_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038173_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038171_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038168_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038165_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038164_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038161_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038160_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038157_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038155_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038153_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038151_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038149_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038147_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038145_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038144_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038137_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038122_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038119_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038113_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038112_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038111_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038108_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038106_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038103_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
MK038102_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038099_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
MK038092_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038082_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038081_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038079_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038078_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038077_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038076_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038075_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038074_HBe_P-B      EALESPEHCSPHHTSLRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038071_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038070_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038068_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038067_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038066_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038064_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038062_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038061_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038059_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038057_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038056_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038055_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038054_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASGELVVSYV
MK038053_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038052_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038051_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038050_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038049_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038048_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038047_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038045_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038041_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038040_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038039_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038038_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038037_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038036_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038035_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038031_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038030_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK038027_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038026_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK038012_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037997_HBe_P-B      EALESPEHCSPHHTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYV
MK037991_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK037972_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037963_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037957_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037952_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037951_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037950_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037948_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037945_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037940_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037936_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK037930_HBe_P-B      EALESPEHCSPHHTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037925_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037914_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037909_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK037902_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK037880_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037877_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYV
MK037867_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037835_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037834_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037831_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037830_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037828_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037827_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037824_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037823_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037820_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037816_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037814_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037813_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
MK037809_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037795_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037793_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037792_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037791_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037790_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037787_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037786_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037785_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037784_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037782_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037703_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037650_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037649_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037648_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037647_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037643_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037640_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037638_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037637_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037627_HBe_P-B      EALESPEHCSPHHTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037626_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037624_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037621_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037618_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037617_HBe_P-B      GALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037615_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037614_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037612_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037611_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037596_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037591_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037569_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037563_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037558_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037556_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037553_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037534_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037533_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037532_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037531_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037530_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037529_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037527_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037526_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037521_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037517_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MH663473_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MH061283_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG826153_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571371_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571369_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571368_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MG571366_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571365_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571364_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571362_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571356_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571355_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571349_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571348_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571347_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571346_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571344_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571342_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571341_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571340_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571323_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
MG571322_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674515_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674513_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674512_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674510_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674509_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674500_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674497_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674495_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674493_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674490_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674488_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674485_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674483_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674482_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674481_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MF674480_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MF674479_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674477_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674476_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674460_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674456_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674455_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674453_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674452_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674451_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674449_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674443_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674438_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674437_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674432_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674431_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674427_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674426_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674424_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674421_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MF674416_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674413_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674410_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674409_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
MF674405_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674404_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674400_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MF674397_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674395_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674394_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674393_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674387_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674384_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674383_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MF674382_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
M54923_HBe_P-B        EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
LC349878_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
LC349873_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881779_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881778_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881761_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881760_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881759_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881757_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881756_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881753_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881752_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881747_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881746_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881745_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881741_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881740_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881735_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881734_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881733_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881732_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881731_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881730_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881729_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881728_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881727_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881726_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881725_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881724_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881723_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881722_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY881721_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689563_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689553_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689546_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689538_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689517_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689480_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689477_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689472_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689443_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689426_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689413_HBe_P-B      EALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYV
KY629636_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY470962_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY470956_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY470953_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KX765856_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KX276824_HBe_P-B      EALESPEHCSXHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964165_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964164_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU964155_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963989_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963988_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963987_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963986_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963985_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963984_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963983_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963982_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963981_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963980_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963979_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963978_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963977_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963976_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963975_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963974_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963973_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963972_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963971_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963970_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963969_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963968_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963967_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963966_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963965_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963964_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963963_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963962_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963961_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963960_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963959_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963958_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963957_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963956_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963955_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963954_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963953_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963952_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963951_HBe_P-B      EALESPEHCSPHHTALMQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963950_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963949_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963948_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963947_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963946_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963945_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963855_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963854_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963853_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963852_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963851_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963850_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963849_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963848_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963847_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963846_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963845_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963844_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963843_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963842_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963841_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963840_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963839_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963838_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963837_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963836_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963835_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963834_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963833_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963832_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963831_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963830_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963829_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963828_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963827_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963826_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963825_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963824_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963823_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963822_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963821_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963820_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963819_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963818_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963817_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963816_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963815_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963814_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963813_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963812_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963811_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963810_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963809_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963808_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963807_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963806_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963805_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963804_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963803_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963802_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963801_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963800_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU963799_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668330_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYV
KU668307_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668300_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668299_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668149_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668133_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668115_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668093_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668076_HBe_P-B      KALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668069_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668061_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668046_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668037_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU668009_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667996_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667879_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667840_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667784_HBe_P-B      EALESPEHCSPHHTALRQAILCWGGLMNLATWVGSNLEDPASREAVVSYV
KU667700_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667612_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYV
KU667569_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667515_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667508_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667484_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667469_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667460_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667457_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667438_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU667422_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREFVVSYV
KU667412_HBe_P-B      EALESPEHCSPHHTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU577089_HBe_P-B      DALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KU577081_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576940_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYV
KU576873_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576872_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576871_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576870_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576869_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576868_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576867_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576866_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576806_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYV
KU576804_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYV
KU576794_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYV
KU576793_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576788_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576785_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576784_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576783_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576782_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576781_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576780_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576778_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576777_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576327_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576326_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576325_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576324_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYV
KU576321_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576320_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576319_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576310_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576052_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576045_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576043_HBe_P-B      EALESPEHCSLHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576039_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576038_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576024_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576022_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU234318_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KR232337_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KR152339_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP406292_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KP406281_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KP243503_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243476_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243470_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243468_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243451_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243440_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243437_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243277_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP243205_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148583_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148580_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148461_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148457_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148456_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148455_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148453_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148451_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148440_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148439_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148438_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148435_HBe_P-B      EALESPEHCSPHHTALRQAIPCWDELMNLATWVGSNLEDPASRELVVSYV
KP148430_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148429_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148427_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148425_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148424_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148423_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148421_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148420_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148419_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148418_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148414_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148411_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148409_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148406_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148405_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP148403_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148402_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148401_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148400_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148398_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148397_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148396_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148395_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148394_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148390_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148389_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148388_HBe_P-B      EALESPEHCSPHHTALRQAILCWGALMNLATWVGSNLEDPASRELVVSYV
KP148387_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148386_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148385_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148384_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148383_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148380_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148379_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148378_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148377_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148376_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148375_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148374_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148373_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148372_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148371_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148370_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148369_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148368_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148365_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148362_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148361_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148360_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148359_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148357_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148356_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148349_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148348_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148347_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148346_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148344_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148343_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148342_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148341_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148340_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148339_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148338_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148336_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148334_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148333_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148331_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148330_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148327_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148326_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148325_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148324_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148323_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148322_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148321_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148320_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148319_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148318_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP148317_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KM392084_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KM392083_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KM392072_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KM359440_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803817_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803797_HBe_P-B      DALESPEHVSAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803787_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803784_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803783_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KJ803764_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ803763_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ410517_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ410516_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ410507_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ410490_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173425_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173424_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173423_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173422_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173421_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173420_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173417_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173416_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173415_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173414_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173413_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173412_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173411_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173410_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173409_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173408_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173407_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173406_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173405_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173404_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173403_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173402_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173401_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173400_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173399_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173398_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173397_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173390_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173389_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173388_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173387_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173382_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173381_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173379_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHV
KJ173376_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173375_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173374_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173370_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173369_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173367_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173366_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173365_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173364_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173361_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173360_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173359_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173357_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173356_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173355_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173354_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173353_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173352_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173351_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173347_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173345_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173343_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173342_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173341_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173340_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173339_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ173297_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ019238_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ019236_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ019233_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ019232_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KJ019231_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167174_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167158_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167092_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167079_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167051_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167028_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF167001_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166796_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166786_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166758_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166390_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166250_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KF165903_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165664_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165561_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165516_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165497_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165492_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KF165411_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KF165341_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165299_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165136_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165108_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165107_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165079_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF165045_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KF164905_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF164875_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF164853_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF164852_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885519_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885462_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885426_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885369_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885345_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885331_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885327_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885326_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885317_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885308_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885305_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885175_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885120_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC885110_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836874_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836865_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836864_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836863_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836861_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836857_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836853_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836843_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836841_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC836830_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774418_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774416_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774413_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774411_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774409_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774408_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KC774404_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774403_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774401_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774399_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774398_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774394_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774393_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774392_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774390_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774388_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774387_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774386_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774384_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774382_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774381_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774380_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774378_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774376_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
KC774374_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774372_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774370_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774368_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KC774366_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC774363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510660_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510659_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510658_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510657_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510656_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510655_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510654_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510653_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510652_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510651_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510650_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510649_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510648_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510647_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510646_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510643_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510642_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KC510641_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX978431_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX869999_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848311_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848310_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848244_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848216_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848201_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASLELVVSYV
JX848174_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848158_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848113_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848108_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848103_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848101_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848093_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848092_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848049_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848030_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848020_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847997_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847994_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847965_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847962_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847959_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847958_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847956_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847952_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847943_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847938_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847910_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847896_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847895_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847894_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847893_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847890_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX847889_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661484_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661483_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661482_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661481_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661478_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661475_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661474_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661473_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661472_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661471_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX661470_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX507215_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX507210_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX429908_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX429902_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX429899_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPVSRELVVSYV
JX079938_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ801514_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ801512_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ801507_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ801479_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ801471_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ688405_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341530_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341510_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341496_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341486_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341485_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341484_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341481_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341477_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341470_HBe_P-B      EALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341465_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341464_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341489_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KY689485_HBe_P-B      EALESPEHCSPHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYV
KY689414_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYV
KY689408_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848075_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848038_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
JX847885_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341502_HBe_P-B      EALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYV
JQ341483_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341467_HBe_P-B      EALESPEHCSPHHTALRQAIXCWGEXMNLATWVGSNLEDPASRELVVSYV
JX848263_HBe_P-B      EALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYV
JQ341463_HBe_P-B      EALESPEHCSPHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYV
JQ341504_HBe_P-B      EALESPEHCSPHHTALRQAILCWXELMNLATWVGXNLEDPASRELVVSYV
FJ562296_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341491_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848179_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576856_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDSASRELVVSYV
KU576623_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576240_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576619_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576620_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576629_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576630_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576633_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576640_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576641_HBe_P-B      GALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576645_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576647_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576656_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576681_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576692_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576693_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576698_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576703_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576704_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576714_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576738_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576748_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576751_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576766_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576843_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELINLATWEGSNLEDPASRELVVSYV
KU576845_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576848_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576854_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576874_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
GU815701_HBe_P-B      EALESPEHCSPHHTALRQAVLCWVELMNLATWVGSNLEDPASRELVVSYV
EF494380_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLDDPASRELVVSYV
GU815552_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYV
GU815564_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYV
GU815669_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYV
MK534727_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPSSRELVVSYV
AB493833_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB334299_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB334300_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB334301_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB334302_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB334303_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
AB355454_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
EU487256_HBe_P-B      EALESPEHCSPHHTALRQAMLCWGELMNLATWVGSNLEDPASRELVVSYV
MK038448_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPASRGLVVSYV
DQ144550_HBe_P-B      EALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038461_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYV
MK038298_HBe_P-B      EALESPEHCSPHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038209_HBe_P-B      EALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYV
MK038180_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLTTWVGSNLEDPASRELVVSYV
MK037794_HBe_P-B      EALESPEHCSSHHTALRQAILCWGELMNLTTWVGSNLEDPASRELVVSYV
MT426980_HBe_P-B      EALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYV
MT426878_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK038454_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYV
MK038293_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYV
MK038063_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYV
MK038058_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYV
MK037971_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK037869_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK037675_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK037672_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MK037528_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMYLATWVGSNLEDPASRELVVSYV
MK037512_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
KX276821_HBe_P-B      EALESPEHCSPHHTALRQAXLCWGELMXLATWVGSNLEDPASRELVVSYV
KY689557_HBe_P-B      EALESPEHCSPHHTALRQAXXCWGELMNLATWVGSNLEDPASRELVVSYV
FJ562311_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDQGSRDLVVGYV
KF164957_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLQDPASRDLVVQYV
KU964381_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964382_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964383_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964384_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964385_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964388_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964391_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964393_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964395_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964397_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYV
KU964386_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KU964387_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KU964389_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KU964390_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KU964392_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KU964396_HBe_P-B      EALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYV
KY689469_HBe_P-B      EALESQEHCSAHHTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYV
KY689516_HBe_P-B      EALESQEHCSAHHTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYV
KU668003_HBe_P-B      EALESPEHCSPHHTTIRQAILCWGELMNLATWVKNNLKDPTSRELVVGYV
KU576069_HBe_P-B      EALEAPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576070_HBe_P-B      EALEAPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ386648_HBe_P-B      EALESPVHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYV
AJ298864_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYV
MG826152_HBe_P-B      EALESPEHCSAHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVNYV
HM011474_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYV
AY269102_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVDYV
KX012624_HBe_P-B      EALESPEHCSPHHTALRQAFLCWGELMTLATWVGSNLEDPASRDLVVSYV
AB713530_HBe_P-B      EALESPEHCSPHHTALKQAILCWGELMNLATWVGSNLEDPACRDLIVSYV
AB231909_HBe_P-B      EALESPEHCSPHHTAPRQAILCWGELMNLATWVGSNLEDPASRELIVSYV
AB908300_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYV
AY596110_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYV
KP406264_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406255_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406263_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406265_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406268_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406270_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406272_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406278_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406279_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KP406261_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
KU668309_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU667987_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576702_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576707_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576718_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU667997_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU668332_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576713_HBe_P-B      EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYA
X98077_HBe_P-B        EALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLEDQASRDLVVSYV
KF165461_HBe_P-B      EALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDQASRELVVSYV
KF165545_HBe_P-B      EALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDQASRELVVSYV
GQ924635_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
EF473973_HBe_P-B      EALESPEHCSPHHTALRQAILGWGELMNLATWVGSNLEDPASRELVVSYV
DQ993687_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYV
AY596111_HBe_P-B      EALESPEHCSSHHTALRQAIVCWGELMNLATWVGSNLDDPASRELVVGYV
AF480364_HBe_P-B      EALQSPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF282917_HBe_P-B      EALESPEHSSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AF282918_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYV
X97851_HBe_P-B        EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYV
AF480337_HBe_P-B      EALESPEHCSPHHTALRQASLCWGELMNLATWVGSNLEDPASRELVVSYV
AF480344_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480356_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
HM011487_HBe_P-B      EALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLDDPASRELVVGYV
GQ377644_HBe_P-B      EALESPEHCSPHHTAIRQCILCWGELMNLATWVGSNLEDPASRELVVGYV
JF436921_HBe_P-B      EALESPEHCSHHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY382514_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRELVVSYV
AB713532_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GQ855559_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
JX848236_HBe_P-B      EALESPEHCSPPHTALRQAILCWGELMNLPTWVGSNLEDPASRELVVGYV
JN104470_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
AB900110_HBe_P-B      EALESPEHCSPHHTAIRQAIICWGELMNLATWVGSNLEDPSSREAVVGYV
FJ562224_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ562253_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ386688_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY269105_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYV
AB212626_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY220703_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY220704_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
EU939639_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ562257_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AB241116_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYV
AB241117_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY269128_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPSSRELVVGYV
EU660224_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
EU881998_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
EU882004_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ032349_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ386675_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
FJ562289_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYV
FJ751769_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
GQ377519_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AY167098_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EU939633_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EU939634_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KU576299_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576308_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
GQ924638_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVSYV
AB073825_HBe_P-B      EALESPEHCTAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
DQ361535_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
EF494381_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYV
MK038341_HBe_P-B      EALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRKLVVSYV
MK038268_HBe_P-B      EALESPEHCSPRHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYV
KX276809_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU668173_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYV
KU667858_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPASRGLVVSYV
KU576637_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYV
KU576303_HBe_P-B      EALESPEHCTPHHAALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KU576300_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
KP406163_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGGNLEDPASRELVVGYV
KF166717_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYV
JX848132_HBe_P-B      EALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYV
JX848124_HBe_P-B      EALESPEHCTPHHTALRQAIVCWGELMNLATWVGSNLEDPASREAVVSYV
GU815587_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSKLEDPASRELVVSYV
GQ855526_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
GQ358147_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWLGSNLKDPASRELVVSYV
GQ358145_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWLGSNLKDPASRELVVSYV
FJ032357_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
FJ032358_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEGPASRELVVSYV
EU939669_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYV
FJ899779_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYV
EU939559_HBe_P-B      EALESPEHCSAHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYV
EF494382_HBe_P-B      EALESPEHCSAHHTALRQAIVCWGELMNLATWVGGNLEDPGSRELVVGYV
EF134946_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ341462_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EF134945_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
DQ904357_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYV
DQ144561_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATRVGSNLEDPASRELVVSYV
DQ144598_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATRVGSNLEDPASRELVVSYV
AF480361_HBe_P-B      EALESPEHCSPHHTALRQDILCWCELMNLATWVGSNLEDPASRELVVSYV
AF480351_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLTTWVGSNLEDPASRELVVSYV
AF480350_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480353_HBe_P-B      EALESPEHCSPHHTALRQNILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480349_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815657_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480346_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480359_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480360_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480363_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480343_HBe_P-B      EALESPEHCSPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480340_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480347_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480352_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480354_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480358_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AF335754_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYV
FJ023575_HBe_P-B      EALESPEHCSPHHTALRQAILCWVELMNLATWVGGNLEDPASRELVVSYV
AF335748_HBe_P-B      EALESPEHCSPHHTALRQAIQCWGEVMNLATWVGSNLEDPASRELVVSYV
AB908299_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
FJ023633_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB713531_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
FJ023636_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB713528_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JQ027316_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB219426_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480348_HBe_P-B      EALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYV
AB212625_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AB073833_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB246340_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AY269110_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073821_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480338_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480345_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480357_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480362_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB355453_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AF480342_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
D00330_HBe_P-B        EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MT757454_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
MK037669_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYV
MG571327_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYV
KY881850_HBe_P-B      EALESPEHCSPHHTALRQVIVCWGELMNLATWVGSNLKDPASRELVVSYV
KX276806_HBe_P-B      EALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDXXSRELVVGYV
KU668012_HBe_P-B      EALESPEHCSPHHTALRQAILCWGGSMNLATWVGSNLEDPASRELVVGYV
KU667640_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVGYV
KP406175_HBe_P-B      EALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYV
KP406172_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP406170_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KP406168_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
KF166875_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVSYV
KF166549_HBe_P-B      EALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYV
JX848265_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYV
JX848149_HBe_P-B      EALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
JX848136_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLQDPESRELVVGYV
JX848024_HBe_P-B      EALDSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815754_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GU815712_HBe_P-B      ETLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
GQ358144_HBe_P-B      EALESPEHCSPHHTALRKAILCWGELMNLATWVGSNLEDPASRELVVSYV
FJ386676_HBe_P-B      EALESPEHCSPHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYV
FJ386600_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
EU439020_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
EU306703_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYG
EF473974_HBe_P-B      EALESPEHCSPHHTALRQAILGWGELMNLATWVGRNLEDPASRELVVSYV
AM888201_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB033554_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
AB073822_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
AF157023_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
AF335738_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
EU796066_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
MK040760_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYV
MK038326_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038188_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK038123_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
MK037910_HBe_P-B      EALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYV
KU576306_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRGLVVGYV
KU575966_HBe_P-B      EALESPEHCSPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVGYV
JQ707744_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYV
AB493827_HBe_P-B      GALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB033555_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB048705_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073826_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073827_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073828_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073829_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073834_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB073840_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB115551_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB195933_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB195934_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB195935_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB205119_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB219428_HBe_C-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB219429_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB219430_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB246339_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYV
AB287328_HBe_P-B      EALESPEHCSPHHTALRQAILCWGELMN